KEGG   Camelus dromedarius (Arabian camel): 105090499Help
Entry
105090499         CDS       T04642                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    105090499
   04614 Renin-angiotensin system
    105090499
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    105090499
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    105090499
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105090499
Peptidases [BR:cdk01002]
 Metallo Peptidases
  Family M2
   105090499
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105090499
CD molecules [BR:cdk04090]
 Proteins
  105090499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 763 aa AA seqDB search
MDLPGPCLLVLFCYGQLLPWVRTKGDQDSDKLYNETVAKTFLQFYEHTAQVVWNQFMEAT
WNYVTNITKKNREEMLHKDMERSQHTLYFGTRARLFNIANFQDPDVKRMLSNLQNIGKAA
LPKDKLQEYNQILAYMETTYSMGQVCLNEGPCLSLEPDLEEVMATSRDQKELLWAWQGWR
DAVGRQLRTTFERYVQLSNKAAKLNGYKDMGALWRSTYESNMLEEDLEKLYQELQPLYLN
LHSYVRRALHRFYGPELIDLRGPIPAHVLGNMWAQSWVSILDLVLPFPEKPPEDITKIMK
GQHWKPEKMFQEAEKFFTSLGLLSTPPEFWKNSMMERPTDGREVECHASSWDFYNGKDFR
IKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRKGANPAFEEAVGSVVTLSASSHKY
LLNRGLLSHQHQDSEEEVNFLMGIALQKIAFIPFAYLVDLYRWKIFDGTIQKAVYNQEWW
SLRLKYQGLCPPVARSEEDFDPGAKFHISASLPYIRYFISLVLQFQFHEALCKASGHMGP
LHRCDIYNSKEAGKLLEDVLKLGWSKPWPEVLEKITGETKVSAKALMTYFKPLLDWLVTE
NVRHGDILGWPDFSCSFEGTLPSSTCSINPFLDLELDPDQAKFGQWMLLALSFVMFLVVL
LLAYRLYTLQKRLLTQDTSAQDTSAQDTSAQDTSAQDTNALKTPPKAYFLGIAMEPHQVA
KRQWMLLGLCLILILCSISLIIRISTQHNRMPPWMRSDWWSWD
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggacttgcctggaccttgcctacttgtgctcttctgttatgggcagctcttgccatgg
gtcaggaccaagggtgatcaggattcagacaagctctacaatgagaccgtggcaaagacc
ttcctgcagttttacgagcatacagcacaggttgtctggaaccagttcatggaagccacc
tggaactatgtcaccaacatcaccaagaaaaatcgagaggagatgctgcacaaggacatg
gagaggtcccagcacacactatactttggcacccgggcccgcctgtttaacattgccaac
tttcaagacccggacgtgaagcgcatgctgagtaacctgcagaacataggcaaggcggcc
ctgcccaaggacaagctccaggagtacaaccagattctggcctacatggagaccacatac
agcatgggccaggtgtgcctgaatgagggaccctgcctgtccctggagcccgacctcgaa
gaagtcatggccacctcccgggaccaaaaggagctgctatgggcctggcagggctggagg
gatgctgtgggtcgccagctccgcaccacctttgagcgctatgtgcagctcagcaacaag
gctgcaaagctcaacggttacaaagacatgggggccttgtggcggtccacatatgagtcc
aacatgctggaggaagacctggagaagctctaccaggagctgcagccgctctacctgaac
ctacactcctacgtgcgccgggccctgcaccgcttctacgggcccgagctcatcgacctg
agggggcccatccctgcccacgtcctggggaatatgtgggctcagtcctgggtcagcatc
ttagacctggtcctccctttcccggagaagccccctgaggacatcacaaagatcatgaaa
ggccagcactggaagcccgagaaaatgttccaagaggctgaaaaattcttcacctccctg
gggctgctttccacccctcctgagttctggaaaaattccatgatggaaaggccaacggac
gggcgggaggtggagtgccacgcgtcctcctgggacttctacaacggcaaggacttcagg
ataaagaagtgcaccgaggtgaccatagaagacctgctctccatcttccaccagatgggc
catatccagtacttcctgcagtacaagaacctctccgtgatcttccgcaaaggtgccaac
ccagcctttgaagaagctgtggggtcagtggtcaccctctcggcctcctcccacaagtac
cttcttaaccgaggactgctcagccaccagcaccaggactcagaggaggaggtcaatttc
ctgatgggcattgccctgcagaagatcgccttcatccccttcgcctacctggtggacctg
tatcgctggaagatctttgatggcaccatccagaaggctgtctacaaccaggagtggtgg
agcctcaggctgaagtaccagggtctgtgcccccctgtcgctcggtcagaggaagacttt
gatccaggcgccaagttccacatctctgccagcctgccctacatacggtacttcatcagc
ctagtgctccagttccagttccacgaagcgctctgcaaggcctcgggccacatgggaccg
ctacaccgctgtgacatctataactccaaggaggctggcaagcttctggaggatgtccta
aagctgggctggagcaagccctggccagaagtcctggagaagataactggggagaccaag
gtgtctgcaaaggccctcatgacctacttcaagcccctgctggactggctggtcactgag
aatgtgcggcatggggatatcttgggctggccagacttcagctgttcctttgaaggcacc
ctccccagttctacctgctctataaacccattcctggatctggagctggaccctgaccag
gccaaatttgggcagtggatgttactggccctgagctttgtcatgttcctggtggtcctg
ctgctggcctacaggctgtacaccctgcaaaaaaggttactgacccaagacaccagtgca
caggacaccagtgctcaggacaccagcgcacaggacaccagtgcacaggacaccaatgca
ctcaagacgccacccaaagcctacttcctgggcatagccatggagccccaccaggttgcc
aaaagacagtggatgctgctgggactctgcctcatcctgatactgtgctcaatcagcctg
atcattcggatttccacacagcacaacaggatgcctccgtggatgagatctgactggtgg
agctgggactag

DBGET integrated database retrieval system