KEGG   Camelus dromedarius (Arabian camel): 105096047Help
Entry
105096047         CDS       T04642                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105096047 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 105096047
NCBI-ProteinID: XP_010986590
LinkDB All DBs
Position
Un
AA seq 696 aa AA seqDB search
MSELQNINWQTASNRQAHHTNKFYSRDLIVRRGQPFYISLKSNQNLGSRASLTFIASTGP
YPSESAKTKAVFPLSSGTRSSGWGAQLVSNENNVLNISILSPANAPIGRYTLGIQISAQG
SASTQNLGTFILLFNPWLQADAVFMNNQAEREEYVQEDAGIIFVGSANRIGMIGWNFGQF
EEGILNICLAVLDNSLNFRRDPATDVARRSDPKYVGRVLSAMINGNDDNGVISGNWSGSY
PGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRSFGIPSRVITNFNSAH
DTDGNLSVDVYYDPMGRPMDKGSDSVWNFHVWNEAWFVRTDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIALREGNVDWDFDMPFIFAEVNADRITWIYNASNGTMKKNSSDSHTIGR
YISTKAVGSNSRMDVTEKYKYPEGSSQERRVFEKALGKMKPSASFGPTSVSMSARSERRE
DREPSISGKFKVTGILEVGKEVSLALILKNLTSDKKTVMVNMTAWTIVYNGTLVHEVWKD
SITISLDPKEEIQHPVKISYAQYEKHLKADNMIRTTAVCQVTNEAEVVVERVVILDNPTL
TLEVLDQAQVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGSLKIDVPGLRPKERSRV
RFEILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactccagaatatcaactggcagacagcctccaaccggcaggcacatcacaca
aacaagttctacagccgggatcttatcgtgcggagaggccaacccttctatatctcattg
aaatccaaccagaatcttggctctagagcaagtctgacattcatagcctccacagggcct
tacccctcagagtcggccaagacaaaggctgtgtttccactctccagtgggacaagaagc
agtggctggggtgcacaacttgtatccaacgagaacaacgttctgaacatctccatcctc
agtcctgccaatgcacccattggaaggtacacgctgggcattcagatctccgcccagggc
agtgcctctactcagaaccttgggacattcatactgctcttcaatccttggttgcaagcc
gatgctgtctttatgaataaccaggctgagagagaggagtatgtccaggaagacgccggg
atcatctttgtgggaagcgcaaaccgaattggcatgattggctggaactttggacagttt
gaagaaggcatcctgaacatttgcctcgcagtcctggataatagtctgaatttccgccgt
gaccctgctactgatgtggcccgcagaagcgaccccaaatatgtcggccgggtgctgagt
gcaatgatcaatggcaatgatgacaatggtgtgatctctgggaactggagcggtagctac
ccgggcggccgagacccgaggaactggaacggcagcgtggagatcctcaaggagtggcaa
aggtctggcttcaggccagtccgctatggccagtgctgggtcttcgctgggacgcttaac
acagtgctgcggtctttcggaattccctcccgagtgatcaccaatttcaactcagctcac
gacacagacggaaacctcagcgtggatgtgtactacgaccccatgggaaggcccatggac
aaaggcagtgacagcgtatggaatttccacgtctggaatgaagcttggtttgtgcggact
gacctgggaccttcgtacaatggatggcaggttctggacgccaccccccaggagaggagc
caaggggtgttccagtgtggtccggcttcggttattgctctccgagagggtaacgtggac
tgggacttcgacatgcccttcatctttgcggaggtcaacgccgaccgcatcacttggatc
tacaatgcctcgaacggcaccatgaagaagaattcctcggactctcacaccattggcagg
tacatcagcaccaaggcagtgggcagcaactctcgcatggatgtcaccgaaaagtacaag
tatccagaaggttccagccaggaaagacgagtatttgaaaaggctctggggaaaatgaaa
cccagtgcatcatttggtccaacgtctgtttcaatgtctgcacgaagcgagagaagagag
gaccgggagcccagcatctctgggaagttcaaggtcactggcatactggaggtgggcaaa
gaagtcagcctggccctgatactcaaaaacctaacaagtgataagaagacggtgatggtg
aacatgacagcctggaccatcgtctacaatggcacactggtgcacgaggtgtggaaggat
tccatcactatatccctggatcccaaggaagaaatacaacatcccgtgaagatctcctat
gctcagtacgagaagcacctaaaggcggacaacatgatccggaccacagccgtgtgccag
gtcaccaacgaggccgaggtggtagtggagagagttgtcattctggacaaccccactttg
accctggaggtgctggaccaggcccaggtgcagaagcccgtgaacgtgcagatgctcttc
tccaaccctctggacgagccagtgaaggactgcgtgctgatggtggaggggagcggcctg
ctgctgggcagcctcaagatcgacgtgccaggcctgcgccccaaggagcggtcccgtgtg
cgttttgagatcctgcccacccggagtggcaccaagcagctcctcgcagacttctcctgc
aacaagttccctgcgatcaaggccatgctgtccatcgacgtggccaagtga

DBGET integrated database retrieval system