Camelus dromedarius (Arabian camel): 105099546 Help Entry 105099546         CDS       T04642                                  Name (RefSeq) glutathione S-transferase-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk00480   Glutathione metabolism cdk00980   Metabolism of xenobiotics by cytochrome P450 cdk00982   Drug metabolism - cytochrome P450 cdk00983   Drug metabolism - other enzymes cdk01100   Metabolic pathways cdk01524   Platinum drug resistance cdk05200   Pathways in cancer cdk05204   Chemical carcinogenesis - DNA adducts cdk05207   Chemical carcinogenesis - receptor activation cdk05208   Chemical carcinogenesis - reactive oxygen species cdk05225   Hepatocellular carcinoma cdk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     105099546   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     105099546    00982 Drug metabolism - cytochrome P450     105099546    00983 Drug metabolism - other enzymes     105099546  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105099546    05204 Chemical carcinogenesis - DNA adducts     105099546    05207 Chemical carcinogenesis - receptor activation     105099546    05208 Chemical carcinogenesis - reactive oxygen species     105099546   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105099546   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105099546   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105099546  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cdk02000]     105099546 Enzymes [BR:cdk01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      105099546 Transporters [BR:cdk02000]  Other transporters   Pores ion channels [TC:1]    105099546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_N_3 GST_C_2 Motif Other DBs NCBI-GeneID:  105099546 NCBI-ProteinID:  XP_031291391 LinkDB All DBs Position 20:5475679..5484579 Genome browser AA seq 217 aa AA seqDB search MHLHHENLVTTIRDTNNPTFLCIFSGGILMYEEVPMVEMDGMNLVETRAILRYIAAKYDL YGRTPKEQAWIDMYAEGLKDLSDMVKFLPLSLPGEKEMNLQYILERATTRFFPVYEKALR DRGQDFLVGDRQSWTDVQLLEVIFMVEECKPKVLSGFPLLQEFKARISSIPTINKFLQPG SQRKPPLDEDSTEVVKNIFKFEHGMSLKNMGTIIAEH NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atgcatctgcaccacgaaaacttagttactactatcagggacactaataatccaactttc ctttgcatattttcaggtggaatcctgatgtatgaggaagtgcccatggtggaaatggat gggatgaatttggtagaaaccagagccatcctaagatacatcgctgcaaaatacgacttg tacgggaggaccccgaaggaacaagcctggatcgacatgtatgcagaaggcttgaaggac ctcagtgacatggtcaagttcctcccgctctccctgcccggggagaaggagatgaacctc caatacatccttgaaagagccacaacaaggttcttccccgtctatgagaaggcactaaga gaccgcgggcaagattttctggtgggcgatcggcagagctggacggatgtacagctcctt gaagtcatcttcatggttgaagagtgcaaacccaaggtcctctcaggcttccctctgcta caggaatttaaggccagaatcagctccattcccacaattaataaatttctccagcctgga agccagaggaaacctccattagatgaagattccactgaggtcgtgaagaatatattcaaa tttgaacatggcatgtctcttaaaaacatgggtacaataatagctgagcattaa

DBGET integrated database retrieval system