KEGG   Camelus dromedarius (Arabian camel): 105100861Help
Entry
105100861         CDS       T04642                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105100861 (NSD2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    105100861 (NSD2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105100861 (NSD2)
Chromosome [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105100861 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1345 aa AA seqDB search
MKQAPEVVGGTNGKTQSCEVSRECSVFLGKGPLSAGLQEGVVPKFNGHEALPFIPTEKLK
DLTSRVFNGEPGAHDARLRFESPEMKGLGTPPNTTPVKNGSPEIKLKITKTYMNGKPLFE
SSICGDGAAAGPPSEENRHGPESKARRSRKRSMKYDSLLEQGLVEAALVSRISSPSDKKV
PAKKESCANTGRDKDHQLKYTVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQRKSAR
QYHVQFFGDAPERAWVFEKSLVAFEGEGQFEKLRQESAKQAPTKAEKIKLLKPIPGKLRA
QWERGLAQAGAAAGMPAEERKAKFTFLYAGGQLCLNPHVAREAGLATECVGPALEASGVV
DDNDTAVPASTGDQGVPVKRRRGPRLCGPAEGRASDPGAVRSSPQKAAEAGPRRGLGSPP
GRKKAAASTPRGRKGDAASQFLVFCQKHRDEVVAEHPDAPAEEIEELLGSQWDLLTEKQK
ARYHTKFALPAPSQAEEESGHLNGKKRNHTKRRQDPTENVEVEDAPRKRLRTDRHSLRKR
ETVADKTARASSCKATEATSSLKSQAATKHLSDACKPLKKRNRAPPAAPVSLAFSKSSSP
SASFTENEVSDGPGDEPLESPYESADETQTEVSVSSKKSERGVTAKKEHVCQLCEKTGSL
LLCEGPCCGAFHLACLGLSRRPEGRFTCTECASGIHSCFVCKEGDADVKRCVVSQCGKFY
HEACVRRYPLTVFESRGFRCPLHSCLSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACL
AAGCLVVASHSIVCTGHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLN
IEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFP
VFFFGSKDYYWTHQARVFPYVEGDRGSRHQGVRGIGRVFKNALQEAEARFREIKLQREAR
ETQESARKPPPYKHIKVNKPYGKVQVHTADISEIPKCNCRPSDENPCGSDSQCLNRMLMF
ECHPQVCPAGEACQNQCFTKRQYPETKIVRTDGKGWGLVAKRDIRKGEFVIEYVGELIDE
EECMARIRRAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDT
RVGLFCVCLPSPGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKASAALSSEEKGK
KTKKKTRRRRTRGEGKKSEDECFRCGDGGQLVLCDRKSCTKAYHLACLGLGKRPFGKWEC
PWHHCDVCGKPSTSFCHFCPNSFCKEHQDGTAFSSTQDGQPYCCEHDWRAEPARGAKTES
PCAEPAKTKGRRKRRRCWRRVTEGK
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggccccggaggtcgttggcggcacaaatgggaagacgcagagctgtgaagtg
agccgtgagtgttccgtgttcctcggcaaaggcccgctctccgcaggcctgcaggagggg
gtggtgcccaagttcaacggccacgaggcgctgcccttcatcccgactgagaagctgaaa
gatctcacttcccgcgtctttaacggagagcccggtgctcacgatgccaggttgcgtttt
gagtccccggaaatgaagggacttgggacaccgcctaacactacccctgtcaaaaatggc
tctccggaaatcaagctgaaaatcactaagacgtacatgaatgggaaacctctctttgaa
tcttccatctgtggcgacggtgctgctgctgggcccccatcagaagagaacagacacggt
ccagaaagtaaggcgcggaggagcaggaagagaagcatgaagtacgactccttgctggag
cagggccttgtggaggcagccctggtgtcccggatttcgagtccctcggataaaaaggtt
ccagctaagaaagaatcctgtgcaaacacgggcagagacaaagaccaccagctgaaatac
accgtgggcgatctggtgtggtccaaggtgtccgggtacccatggtggccgtgcatggtc
tcggcggaccccctcctgcacagctacaccaagctgaaaggtcagagaaagagtgcgcgc
caatatcacgtccagttcttcggggacgccccggaaagggcgtgggtgtttgagaagagc
cttgtcgcttttgaaggggaaggacagttcgaaaaattacgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaatcaagctgctgaagcccatcccagggaagctgagggcc
cagtgggagaggggccttgcgcaggcgggagcggccgcgggcatgcctgccgaggagcgc
aaggccaagttcaccttcctctacgcggggggccagctgtgcctcaacccccacgtggcg
agggaggcgggccttgccacggagtgtgtggggccagcgctggaggcctcgggagtcgtg
gacgacaacgacactgctgtccccgcgtccacaggggaccagggtgttcccgtcaagcgg
aggcgggggccccgactgtgtggccctgccgagggccgggctagcgaccctggggccgtg
aggagcagcccgcagaaggcggcggaggccggccccaggagagggctgggctcgccaccg
gggaggaagaaggcagcggcctccacgcccaggggccggaagggcgacgcagcctcgcag
ttcctggtcttctgccagaagcacagggacgaggttgtggccgagcacccggacgcaccc
gccgaggagatcgaggagctgctggggtcccagtgggacctgctcaccgagaagcagaag
gcgcgctaccacaccaagttcgccctgccggccccttcccaggcggaagaagagtctggt
cacttaaatgggaaaaaaagaaaccacacaaagaggagacaggaccctacagaaaacgtc
gaagtggaggacgcacccaggaaaagactcaggactgacaggcacagtcttcggaagaga
gagactgtcgctgacaagaccgcccgagcaagctcttgcaaggccacggaggccacctcc
tctctgaagagccaagcagccacgaagcatctgtctgacgcgtgcaagcccctgaagaag
cggaaccgggcccccccagcggcacccgtgtctctcgcgtttagcaagagttcgtctcct
tctgcctccttcactgagaatgaggtctcggacggcccgggagatgagcccttggagtcc
ccgtacgaaagtgcggacgaaacacagactgaagtgtccgtctcgtctaaaaagtctgaa
cgaggagtgaccgccaaaaaggagcacgtatgtcagctgtgcgagaagactggcagtctc
ctgctctgcgaagggccgtgctgcggtgccttccacctcgcctgcctgggcctctcccgg
aggccggaggggaggttcacctgcaccgagtgtgcttcagggatccactcgtgcttcgtg
tgcaaggagggcgacgcggacgtcaagcgctgcgtggtgtcgcagtgtgggaagttctac
cacgaggcctgcgtgcgcaggtacccgctgacggtgttcgagagccgcggcttccgctgc
ccgctgcacagctgtctgagctgccatgcctccaacccctccaacccgaggccgtccaaa
ggtaaaatgatgcgctgcgtccggtgcccggtcgcctaccacggcggggacgcttgtctg
gcagccggctgcttggtggtcgcttcccacagcatcgtctgcacgggccacttcaccgcc
cggaaggggaagaggcaccacgcccacgtcaacgtgagctggtgcttcgtgtgctccaaa
ggggggagcctgttgtgctgcgagtcctgccccgcggccttccaccccgactgcctgaac
atcgagatgccagatggcagctggttctgcaatgactgcagggctgggaagaagctgcac
ttccaggacatcatctgggtgaagctggggaactacagatggtggccggcagaagtttgc
catcccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccct
gtgtttttctttgggtctaaagattattactggacgcatcaggcgcgagtgttcccgtac
gtggagggggaccggggcagccgccaccagggggtcagagggatcggaagagtcttcaaa
aacgcactgcaagaagctgaagctcgttttcgtgaaatcaaacttcaaagggaggcccga
gaaacgcaggagagtgcgcgcaagcccccgccgtacaagcacatcaaggtgaataagccg
tatgggaaagtgcaggtgcacacggccgacatctctgagatccccaagtgcaactgccgg
cccagcgacgagaacccctgcggctccgactcacagtgcctcaacaggatgctcatgttc
gagtgccacccgcaggtgtgccccgccggcgaggcctgccagaaccagtgcttcaccaag
cgccagtaccctgagaccaagatcgtcaggacagacggcaagggctggggcctggtggcc
aagagggacattagaaagggcgagtttgtgatcgagtacgtgggcgagctgattgacgag
gaggagtgcatggctaggatcaggcgtgcccatgagaacgacatcacgcacttctacatg
ctcaccatagacaaggaccgcataattgacgccggccccaaggggaactactcgcggttt
atgaatcacagctgccagcccaactgtgagaccctcaagtggacagtgaacggggacacg
cgtgtgggcctgttttgcgtttgtctcccttcaccagggacggagctgaccttcaactac
aacctcgactgtttggggaatgagaagacggtctgtcggtgcggagcctccaactgcagt
gggttcctcggggaccgaccaaaggcctcagcagccctttcttcagaggaaaagggcaaa
aagaccaagaagaaaaccaggcggcggcgcacgagaggcgaagggaagaagtcggaggac
gagtgctttcgctgcggcgacggcggccagctggtgctgtgtgaccgcaagtcctgcacc
aaggcctaccacctggcctgcctgggcctgggcaagcggcccttcgggaagtgggaatgt
ccgtggcatcactgtgacgtgtgcggcaaaccttctacttcattttgccacttttgcccc
aattcgttttgcaaggaacaccaggacgggacagccttcagctcgactcaggatgggcag
ccctactgctgcgagcatgactggagggcagagcccgcgagaggtgcaaagactgagtcg
ccctgcgcggagcccgccaagacgaaggggaggaggaagcggaggcggtgttggcggagg
gtcacagaaggcaaatag

DBGET integrated database retrieval system