KEGG   Camelus dromedarius (Arabian camel): 105102789Help
Entry
105102789         CDS       T04642                                 

Gene name
SETD1A
Definition
(RefSeq) SET domain containing 1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105102789 (SETD1A)
Enzymes [BR:cdk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105102789 (SETD1A)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105102789 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     105102789 (SETD1A)
    COMPASS/SET1 complex (yeast)
     105102789 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 Topoisom_I_N
Motif
Other DBs
NCBI-GeneID: 105102789
NCBI-ProteinID: XP_010994531
LinkDB All DBs
Position
Un
AA seq 1607 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGIHFSVNDSKYIPVEDL
QDPRCHVRSKNREFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSSSDTAAFPSGTAAVGTPGNG
TPCSQDTSFSSGRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSAAISATTAATAASSSSSSSSSSSSSSSSSSASHFRG
SDSNYPAYYESWNRYQRHASYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPA
DQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNESVP
FAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSTTGPGVRDTGSEVPSGSGHGPCTP
PPAPANFEDVAPTGSGEPGATRESPKANGQNQASPCSSGEDMEISDDDRGGSPPPAPTPP
QQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRCFVNSLELMDRLGAQWGGMPMSFQ
MQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLPFPPHQEAAYGLPYALYTQGQEGRG
AYSREAYHLPLPMAAEPLPSSSVSGEEARLPPREEAELAEGKALPSAGTVGRVLATLVQE
MKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLL
SLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSEISEASEEKRPRPSTPAEED
EDDAEREKEVGEPGRPGTKPPKRDEERSKTQGKHRKSFALDSEGEEASQESSSEKDEEDE
EEDEEDEEREEAMDAAKKDTEASDGEDEESDSSSKCSLYADSDGENDSTSDSESSSSSSS
SSSSSSSSSSSSSSSSSESSSEEEEEEEQPATIPSASSPPRDVPVPQPAPAEEPEPEQVA
DSPVTPLPEQKSPARPAGSTEELPPSVPQPPPEPPAGPPAPAPRPDERPSSPIPLLPPPK
KRRKTVSFSAVEEVPAPEPPPAAPPQVKSPGPTSRKVPRGLERTIRNLPLDHASLVKSWP
EEVSRGGRSRAGSRGRSTEEEEAEPGTEVDLAVLADLALTPARRGLPSLPPSDDLEATET
VDESDRPSPLLSHILLEHNYALAIKPPPSTPAPRPLEPVPAPAALFSSPADEVLEAPEVV
FEQMTILYDIWNSGLDLEDMSYLRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKR
RPQDGPREHQTGSARSEGYYPISKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQ
RRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQ
NIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITI
ESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaagccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccttacgcaggccttctcaaaaggtgtac
agatacgatggaatccacttcagtgtcaacgactcaaagtatattccagtcgaagacctc
caagacccccgttgccacgtcaggtccaaaaacagagaattttccctcccagtccctaag
tttaagctggatgagttctatattggacagatcccactgaaagaagtgactttcgcaagg
ctgaatgacaacgtgcgggagaccttcctgaaggacatgtgccgaaagtatggcgaggtg
gaagaggtagagatccttcttcaccctcgcactcgcaagcacctgggcctggcccgtgtg
ctcttcaccagcactcggggagccaaggaaacagtgaaaaacctccaccttacctctgtc
atgggcaacattattcatgcccagctcgacatcaaaggacaacaacgaatgaagtactat
gaactaatagtcaatggctcctacacccctcagacggtgcccactgggggcaaggccctg
agtgagaagttccaaggctctggtgcagccactgagacgactgaatcccgccgccgctcc
tcctccgacacagctgccttcccatcaggcactgctgcagtgggcactcctggcaatggc
accccctgctcccaggacacaagcttctccagcggccgacaagacaccccctcttccttc
ggccagttcacccctcagtcctcccaaggaaccccctacacatctcggggcagcaccccc
tactctcaggactctgcctactccagcagcaccacttccacctccttcaagccccggcga
tcagagaacagctaccaagattccttctcccgccgccacttctctgcatcttcggccccc
acgaccacctctgcagccatctccgctaccactgcagccaccgccgcatcgtcttcttct
tcctcttcctcctcgtcctcctcgtcgtcctcctcttcctcggcctctcattttcgtggt
tctgactcaaactacccagcatattatgaaagctggaatcgctaccaacgtcatgcttcc
tacccaccccgccgggcaactcgggaggagcctcctggggcaccttttgctgaaaataca
gccgaacgcttcccaccttcctatacctcctacttgccccctgagcccagccggcctgct
gaccaggactatcggcctcctgcctcagaagctccacccccagagcctccagaacctggt
ggaggcgggggtggtggggggcccagtcctgagagagaagaagcccgcacctcccctcgc
ccagcctcacctgctcgttctggctctccagccccagagaccaccaacgagagtgtgccc
tttgctcaacacagcagcctggattcccgcattgagatgttgttgaaggagcagcgctcc
aagttttctttcctggcctctgacactgaggaagaggaagagaacagcaccacaggccct
ggggttagagacacagggagtgaggtgccttctgggtcaggtcacgggccttgcacaccc
cctccagccccagcaaattttgaggatgtggcacctacggggagtggggaaccgggggct
acccgggagtcgcccaaggccaacggacagaaccaggcttctccatgctcttctggagag
gacatggaaatctccgacgatgacaggggcggctcaccccctccggccccaacaccgccc
cagcaacctccaccccctcctcctcctcctccccctcctccgccgtacctggcttccctt
ccccttggttatcctccccaccagcctgcctacctcctcccaccccgatgctttgtgaac
tccctagagctcatggatcgacttggggctcagtggggagggatgcccatgtccttccag
atgcagacccagatgttaactcggctccaccagctgcggcagggcaaaggattgactgct
gcctcagctggtccccccggtggggcttttggggaggcctttctcccattcccgccccac
caagaggcagcctatggcttaccctatgctctgtacacacaagggcaagaaggccgaggg
gcatactcccgggaggcctatcacctgcctttgcccatggcagccgagcccctgccctcc
tcctcagtctcaggagaagaggcccggctgcctcccagggaggaagcagagctggcagag
ggcaaagccctaccatcagcaggcactgtgggtcgtgtgctggccaccctcgtccaagag
atgaagagcatcatgcagcgagacctcaaccgcaagatggtggagaatgtggcctttgga
gcctttgatcagtggtgggagagcaaggaagagaaggccaagccattccagaatgcagct
aaacagcaagccaaggaggaggataaagagaagacaaagcttaaagagccaggcctgctg
tccctcgtggactgggccaagagcgggggtaccaccggcatcgaagccttcgcctttggg
tcagggctgcgaggggccctgcggctgccttccttcaaggtaaagcggaaagagccttcg
gaaatttcagaggccagtgaggaaaagaggccccggccctctactccagctgaggaagat
gaagatgacgctgagcgtgagaaggaggttggagagccaggacgtccggggaccaagccc
ccaaagcgagatgaagagcgaagcaagacccagggcaagcaccgcaagtcctttgctctg
gacagtgagggggaggaggcatcccaggagtcctcctcagagaaggatgaggaggatgaa
gaggaagatgaggaagatgaagagcgtgaggaagccatggatgctgcgaagaaggataca
gaggcatcagatggcgaggacgaggaaagcgattcgtcctccaaatgttctctgtatgct
gactcagatggtgagaatgatagcacgtcggactccgagagcagcagctcatccagctcc
tcatcttcctcatcttcctcctcatcgtcctcatcgtcctcatcatcatctgagtcctcc
tctgaggaagaagaggaagaggagcagccagcaaccataccctcagcatcatcgcccccc
cgagatgtccccgtgccccagccagcacctgcggaggagcccgagccagaacaggttgca
gactccccagtcacacctctccccgaacagaagtctccagcaagacctgcaggttctact
gaggaactgcctcccagtgtgccccagcctccccctgagccaccggctggacccccggcc
cctgctccccgccccgacgagcgcccctcctctcccatccccctcctgcccccacccaag
aaacgccggaaaaccgtctccttttctgccgtggaggaggtgccagccccagagcctccc
cctgctgccccaccgcaggtcaagtctccgggccccacctcccgcaaagtcccccggggc
ctggagcggaccattcgcaacctgcccctggaccatgcgtcactggtcaagagttggcct
gaggaagtgtcccgaggaggtcggagccgcgctggaagccgaggccgctccactgaggaa
gaagaggctgagccagggacagaagtggacctggcggtgctagccgacctggccctgacc
ccagcccggcgcgggctgccttccctgccacccagcgacgacttggaggccacagagaca
gtggacgagtcagaccgcccgagcccccttctcagccacatcctcctggagcacaactac
gccctagccatcaaaccgccgccctccaccccggcccctcggcccctggagccagttcct
gcccctgcagccctcttcagctccccggcagacgaggtcctggaggcccctgaggtggta
tttgagcagatgaccatcctgtatgacatttggaactcaggcctggacttggaggacatg
agctacctgcggctcacgtatgagcgattgctgcagcagacgagtggggctgactggctt
aacgacacccactgggtccatcacaccatcaccaacctgagcactccaaagcgcaagcgg
cggccccaggacgggccccgcgagcaccagacaggctcagcccgcagtgaaggctattac
cccatcagcaagaaggagaaggacaggtacctggatgtgtgccccgtctcggcccggcag
ctggaaggagcggacactcaggggactaaccgggtgctttcggagcgccggtccgagcag
cggcggctgctgagcgccatcggcacctcggccatcatggacagcgatctgctaaagtta
aaccagctcaagttccggaagaagaagctccgattcggccggagccgtatccacgagtgg
ggcctgtttgccatggaacccattgcagctgacgagatggtcatcgaatacgtgggccag
aacatccgccagatggtggccgacatgcgggagaagcgctatgtgcaggagggcattggc
agcagctacctgttccgggtggaccacgacaccatcatcgatgccaccaagtgtggtaac
ctggcaaggttcatcaaccactgctgcacgcccaactgctacgccaaggtgatcaccatc
gagtcccagaagaagatcgtgatctactccaagcagcccattggcgtggatgaggagatc
acctacgactacaagttcccgctggaggacaacaagatcccgtgtctgtgcggcaccgag
agctgccgcggctccctcaactga

DBGET integrated database retrieval system