KEGG   Camelus dromedarius (Arabian camel): 105104405Help
Entry
105104405         CDS       T04642                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105104405 (KMT5B)
Enzymes [BR:cdk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105104405 (KMT5B)
Chromosome [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105104405 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 883 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTVKAGKNAGERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPLINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTVTRQSVSRIPA
SSNSTSSQLTPISNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKSASRKLEMGNLVLKEP
KVVLYKNLPLKKDKEPEGPVPAAVAGGCLTRHAAREHRQNSGRGAALHAEGAACTYTTRR
SVRARTNVKEPPDVKLEPDSLEGCRGILTDPCADGGEQPAPAAQEEDLAREAALKGDAKC
PKSDSSMSKKKSRQGKLVRQLAKAEEATPGHESPGRAGAGLDAVGCPLGQGEHSGAEGVP
GSYTDWAPSPVGGSVVTSDSLKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRR
RHDSSSKTNDQENDGMNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLK
RDEESRGSYTEGLHENGVCCGDPLSLLESRMEVDDYSQYEEESTDASSSSEGDEEEDDYD
DDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcacacgggaaaggacaccgtg
aaggctggcaaaaacgcaggcgagaggaggtcaagcagatgtaatggcaattctggattt
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggaactctgcgagaac
gatgacctagcaaccagtttggttcttgatccctatttaggttttcagacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagttttcct
cacaacaaccctgtgagatttcggcctattaaaggaaggcaggaagaactaaaggaagta
attgaacgttttaagaaagatgagcacttggagaaagctttcaaatgtttgacttcaggc
gaatgggctcggcactattttctcaacaagaacaaaatgcaggagaaattattcaaggag
catgtatttatttacttgcgaatgtttgcaactgacagtggatttgaaatattgccttgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcctgctgcgtttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggctctaagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaataatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctcttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaaatcttcagttggt
gtgaaaaagaacagcaagagcagaactgtaacaaggcagtctgtgtcaagaattccagct
tcttccaactctacctcatctcagctaactcctataagtaattccagggtaccaaagaaa
ctgaaaaagcctgcaaagcctttactttcaaagataaaattaagaaatcattgcaaacgg
ctggagcaaaagagtgcttcgagaaaactcgaaatgggaaacttagtgcttaaagagcct
aaggtagttctgtacaaaaatttgccccttaaaaaagataaggagccagagggaccagtc
ccagccgcagtggctggtgggtgcttaactagacacgcagcaagagagcacagacagaac
tcggggcgaggtgctgccctgcacgcggagggcgctgcctgcacgtacaccaccaggcgg
tcggtgagggcgaggacgaatgtgaaggagccccccgacgtcaagctggaaccagattcg
ctggagggctgtagaggcatcttgacggacccctgcgcagacggcggggagcagccagcc
cctgcggcacaggaagaagacctggctcgtgaagctgcactaaagggggatgccaagtgt
cctaagagtgacagcagcatgtcaaagaagaagtcacggcaaggaaaactggtgagacag
ctggccaaagcagaggaggctactccggggcacgagtcccccgggagagcaggcgcgggg
ctggacgcggtggggtgccccctgggccaaggcgagcacagcggcgcagagggcgtcccc
gggagctacacggactgggccccctcgcctgttggtggttcagtggtgacttcagacagc
ttaaaaacaaaagacagcttccgaactgcaaaaagtaaaaagaagaggcggatcacaagg
tatgatgcacagttaatcctggagaataactccgggattcccaaattgacacttcgtagg
cgtcacgacagcagcagcaagacaaatgaccaagagaatgatgggatgaattcttcgaaa
ataagcatcaagttaagtaaagaccatgaaaatgacaataatctctatgtagcaaagctt
aacaatggatttaactcaggatcaggcagtagttctacaaaattaaaaatccagctaaaa
cgggacgaggagagtcggggctcatacacagaggggcttcatgaaaacggggtgtgctgt
ggcgatcctctttctctcctggagtctcgaatggaggtggatgactacagtcagtacgag
gaggaaagtacagatgcttcctcctcttcagagggagacgaagaggaggatgactatgat
gatgactttgaagatgattttattcctcttcctccggctaagcggctgaggctcatcgtt
gggaaagactctatagatattgacatttcttccaggagaagagaagatcagtctctgagg
ctcaacgcataa

DBGET integrated database retrieval system