KEGG   Cronobacter dublinensis: AFK67_01065Help
Entry
AFK67_01065       CDS       T04061                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00620  Pyruvate metabolism
cdm00680  Methane metabolism
cdm01100  Metabolic pathways
cdm01120  Microbial metabolism in diverse environments
cdm01200  Carbon metabolism
Module
cdm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cdm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK67_01065
  Energy metabolism
   00680 Methane metabolism
    AFK67_01065
Enzymes [BR:cdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AFK67_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALB65152
UniProt: A0A0K2NXV1
LinkDB All DBs
Position
complement(226760..229411)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEADRQALLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEIIARTLRKLKDQPDINEA
AIRQAVEALSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDHKDIADYERNQIMRRLRQ
LIAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEAHLDYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLISELSMVECSDALR
EYVGTEGAQEPYRYLLKGLRAQLLATQGWLEARLKGQKLPKPQGLLTQNEQLWEPLYACY
ESLVSCGLGIIANGELLDTLRRVKAFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSDNTREVLDTCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAAWRHIMDEL
SDISCTMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQDELETMCRDWPFFSTRLGMLEMVFAKADLWLAD
YYDQRLVKQDLWPLGQELRQLLEADIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKPADACVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgaagcaatgtcagtatgctcggcaagttgctcggg
gataccatcaaggatgcgctgggagaaaacatccttgaccgcgtagaaacaatccgcaaa
ttgtcgaagtcttcccgtgctggcaatgaagcagaccggcaggcgctgttaacgacactg
caaaatctctccaatgacgaactgctgccggtggcccgcgcgttcagtcagttcctgaat
ctggccaacacggccgagcagtaccacagcatctcgccaaaaggcgaagccgccagcaac
ccggaaattatcgcccgcaccctgcgtaagctcaaagaccagcccgatatcaacgaagcc
gccatccgtcaggccgtggaagcgctgtcgctggagctggtgctgaccgcgcacccgacc
gaaatcacccgtcgcaccctgatccacaaaatggtcgaagtgaataactgcttgaaacag
ctcgaccacaaagacatcgccgattacgagcgcaaccagatcatgcgccgtctgcgccag
ctgattgcgcagtcctggcacaccgacgaaattcgtaaaaaccgcccaagcccggtggat
gaagccaaatggggcttcgccgtggtggaaaacagcctctgggaaggcgtaccaaactat
ttgcgcgaactgaacgaacagctcgaagcgcatctcgattacaaactgccggtggatttc
gtgccggtgcgtttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtcacc
gccgatattacccgtcacgttctgctgttgagccgctggaaagccaccgatctgttcctg
aaagatatccaggtactgatttctgagttgtcgatggtggagtgcagcgacgcgctgcgc
gaatatgtcggcaccgaaggcgcgcaggagccgtaccgctacctgctcaaagggctgcgc
gcgcagctgctcgccacccagggctggctggaagcccgactgaagggccagaagctgccg
aaaccgcaaggcctgctgacccagaacgaacagctctgggagccgctttacgcgtgttat
gaatcgctggtctcctgcgggcttgggatcatcgccaacggcgaactgctcgacaccctg
cgccgcgtcaaagcgttcggcgtgccgctggtgcgtatcgatatccgtcaggagagcacc
cgccacaccgaagcgctcggcgagctgacccgctatctcggcatcggcgactacgaaagc
tggtcggaagccgataaacaggcgttccttattcgcgagctgaattccaaacgtccgctg
ctgccgcgccagtgggagccgagcgacaacacgcgcgaagtcctcgacacctgcaaagtc
atcgccgaagcaccgaaaggctcgatcgccgcgtatgtcatctccatggcgaaaacgccg
tccgacgtgctggccgtccacctgctgctcaaagaagcgggtatcggcttcgcgctgccg
gtcgcgccgctgtttgaaacgctcgacgacctgaataacgccaacgacgtcatgacccag
ttgctgaacatcgactggtatcgcggtttcattcagggcaaacagatggtgatgattggc
tattccgactccgcgaaagacgcgggcgtgatggccgcctcctgggcgcaataccaggcg
caggacgcactgatcaaaacttgcgagaaagcaggtatcgcgctgacactgttccacgga
cgcggcggttctattggccgcggcggcgcgccagcccacgcggcgctgctctcccagccg
ccgggcagcctgaaaggcggtctgcgcgtcaccgaacagggcgagatgatccgctttaaa
tacggcctgccggaagtgaccatcagcagcctgtcgctctacaccagcgccattctcgaa
gcgaacctgctgccgccgccggagccgaaagccgcctggcgacatatcatggatgagctc
tccgacatctcctgcaccatgtatcgcggctacgtgcgcgaaaacaaagacttcgtgccg
tatttccgttcggccacgccggagcaggagcttggcaaactgccgctcggctcgcgtccg
gcgaagcgtcgcccgaccggtggcgtggaatcgctgcgcgccattccgtggattttcgcc
tggacccagaaccgcctgatgctgcccgcctggcttggcgccggcgccgcgctgcaaaaa
gtggttgaggacggcaaacaggacgagctggaaaccatgtgccgcgactggccgttcttc
tccacgcgcctcggcatgctggagatggttttcgccaaagcggatctgtggctggcggac
tattacgatcagcgcctggtgaaacaggatctctggccgctcggtcaggagctgcgccag
ttgctggaagccgatatcaaagttgtactggatatcgccaacgactcgcatctgatggcg
gatctgccgtggattgccgagtccatccagctgcgcaacatctataccgacccgctgaac
gtgctacaggcagagctgctgcaccgctcgcgtcaggccgaagaagaaggcaaaccggca
gatgcgtgcgtggaacaagcgctgatggtcaccatcgcaggcgtcgcggcgggtatgcgt
aacaccggctaa

DBGET integrated database retrieval system