KEGG   Castellaniella defragrans: BN940_13101Help
Entry
BN940_13101       CDS       T03058                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00020  Citrate cycle (TCA cycle)
cdn00310  Lysine degradation
cdn00380  Tryptophan metabolism
cdn01100  Metabolic pathways
cdn01110  Biosynthesis of secondary metabolites
cdn01120  Microbial metabolism in diverse environments
cdn01130  Biosynthesis of antibiotics
cdn01200  Carbon metabolism
Module
cdn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN940_13101
  Amino acid metabolism
   00310 Lysine degradation
    BN940_13101
   00380 Tryptophan metabolism
    BN940_13101
Enzymes [BR:cdn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BN940_13101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: CDM25070
UniProt: W8X9M2
LinkDB All DBs
Position
complement(2834145..2837024)
Genome map
AA seq 959 aa AA seqDB search
MSTEQELQSNSYLFGANAPYVEDLYEAYLDNPGSVPDQWRSYFDQLQHQPAVDGREATRD
QAHAPIVASFAQRARENAFQIRPAQASDQSLAIASKQVYVQSIIAAYRSLGSRIAQLDPL
KRRDRPEIPELDPAFYGLSEADLDQIYSATNTYFTKADTMTMRDILKALRDTYCRNVGAE
FMHISDPAVKRWIQERLESTLGVPELSVDEKRNILRQVTEAEGLERFLHTKYVGQKRFSL
EGGESFIASMDEVVNHAGENGVQEIVVGMAHRGRLNMLVNIMGKMPGDLFAEFEGKHAQS
LSDGDVKYHNGFSSDLSTRGGPVHLSLAFNPSHLEIVNPVVEGSVRARQDRRGDAAGDQV
LPVLVHGDAAFAGQGVVMETLNLAQTRGYGTGGTLHIVINNQIGFTTSDPRDTRSTLYCT
DVVKMIEAPVFHVNGDDPEAVVFVTRLALDYRQQFKHDVVVDIVCFRKLGHNEQDTPSLT
QPLMYKSIGTHPGTRKLYADRLVAQGVLAEDEPDQMVKDYRQLMEDGQRTVEPVLTDYKN
KYSTDWSPFLGAKWTDHADTGVPLAELTRIGERLTQVPDGFTVHPLVKKLLADRLAMARG
EHPVDWGMGEHLAFATLVANGYAIRITGQDSGRGTFTHRHAVLHDQKRERWDDGTYVPLQ
NVSENQAPFTVIDSVLSEAAVLGFEYGYATAEPNVLTIWEAQFGDFANGAQVVIDQFITS
GEAKWGRQCGLVLMLPHGYEGQGPEHSSARIERFLQLCADNNIQAVQPTTGAQIFHVLRR
QMIRPFRKPLVLFTPKSLLRNKNATSPLEDLATGTFQPVIGETDAEIVPADVKRVQVCSG
KVYYDLVHARAEQGRKDVAILRIEQLYPFAHKSFQAELQKYPNAKELVWVQDEPQNQGPW
FYVQHHLYENMSDGQKLGYAGRPASASPAVGYLAKHQEQQRALIEQAFSPKLKSFSLIK
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggaacaagaactccagtccaattcctatttgttcggcgccaatgcgccctac
gtagaagacctctacgaagcctatctagacaacccgggttccgttccggaccagtggcgt
tcctacttcgatcagctgcagcaccagcccgccgtcgatggccgcgaagccacccgcgac
caggcccacgccccgatcgtcgcctccttcgcccagcgcgcccgcgagaacgccttccag
atccgccccgcgcaggcctccgaccagtccctggccatcgccagcaagcaggtctacgtc
cagtcgatcatcgccgcctaccgctcgctgggctcgcgcatcgcccagctcgaccccctg
aagcgccgcgaccgtccggaaatcccggaactggatcccgccttctacggcctgtccgag
gccgacctcgaccagatctattcggccacgaacacgtatttcaccaaggccgacacgatg
accatgcgggacatcctcaaggccctgcgtgacacgtactgccgcaacgtcggcgccgaa
ttcatgcacatctccgatccggcggtcaagcgctggatccaggagcgcctggaatccacg
ctgggcgtgcccgagctctccgtcgacgaaaagcgcaacatcctgcgccaggtgaccgag
gccgaaggcctggaacgcttcctgcacaccaagtacgtcggccagaagcgcttctccctg
gaaggcggcgagagcttcatcgcctcgatggacgaggtcgtgaaccacgccggcgagaac
ggcgtccaggaaatcgtcgtgggcatggcccaccgcggccgcctgaacatgctggtcaac
atcatgggcaagatgcccggcgacctgttcgccgaattcgagggcaagcacgcccagtcc
ctgagcgacggcgacgtcaagtaccacaacggcttctccagcgacctgtccacgcgcggc
ggcccggtccacctgtcgctggccttcaacccctcgcacctggaaatcgtcaacccggtg
gtcgaaggcagcgtgcgcgcccgccaggatcgccgcggcgacgcggccggcgaccaggtc
ctgccggtgctggtgcacggcgacgcggccttcgccggccagggcgtggtgatggaaacc
ctgaacctggcccagacgcgcggctacggcacgggtggcacgctgcacatcgtcatcaac
aaccagatcggcttcacgacctcggacccgcgcgacacgcgctccacgctgtactgcacg
gacgtggtcaagatgatcgaggcccccgtcttccacgtcaacggcgacgatcccgaggcc
gtggtcttcgtcacccgcctggccctggactaccgccagcagttcaagcacgacgtggtc
gtggacatcgtctgcttccgcaagctgggccacaacgagcaggacacgccgtccctgacc
cagccgctgatgtacaagagcatcggcacgcaccccggcacgcgcaagctctacgccgac
cgcctggtggcgcagggcgtgctggccgaggacgagcccgaccagatggtcaaggactac
cgccagctcatggaagacggccagcgcacggtcgagccggtgctgaccgactacaagaac
aagtattccaccgactggtcgccgttcctgggcgccaaatggacggaccacgccgacacc
ggcgtgcccctggccgaactgacccgcatcggcgaacggctcacccaggtgccggacggc
ttcaccgtgcatccgctggtcaagaagctgctggccgaccgcctggccatggcgcgcggc
gagcatcccgtggactggggcatgggcgagcacctggccttcgccaccctggtggccaac
ggctacgccatccgcatcaccggccaggattccggccgcggcaccttcacccaccgccac
gccgtgctgcacgaccagaagcgcgagcgctgggacgacggcacctacgtgccgctgcag
aacgtctccgagaaccaggcgccgttcacggtgatcgactccgtgctgtccgaagccgcg
gtgctgggctttgaatacggctacgccaccgccgagcccaacgtgctgaccatctgggaa
gcccagttcggcgacttcgccaacggcgcccaggtcgtgatcgaccagttcatcacctcc
ggcgaggccaagtggggccgccagtgcggcctggtgctgatgctgccgcacggctacgaa
ggccagggtcccgagcactcctcggcgcgcatcgagcgcttcctgcagctgtgcgcggac
aacaacatccaggccgtgcagccgaccaccggcgcgcagatcttccacgtgctgcgccgc
cagatgatccggcccttccgcaagccgctggtcctcttcacgcccaagtcgctgctgcgc
aacaagaacgccacctcgcccctggaggacctggccaccggcaccttccagcccgtgatc
ggcgagaccgacgcggagatcgtgccggccgacgtgaagcgcgtgcaggtgtgctccggc
aaggtctactacgacctggtccacgcgcgggccgaacagggccgcaaggacgtggccatc
ctgcgcatcgagcagctctatcccttcgcccacaagtccttccaggccgaactgcagaaa
tatcccaacgccaaggagctggtctgggtccaggacgagccgcagaaccaggggccgtgg
ttctacgtgcagcaccacctgtacgagaacatgagcgacggccagaagctcggctacgca
ggccgcccggcctcggcctcgcccgccgtgggctacctggccaagcaccaggagcagcag
cgcgccctgatcgagcaggccttttcgcccaagctcaagagcttctcgctgatcaagtaa

DBGET integrated database retrieval system