KEGG   Chelatococcus daeguensis: BOQ54_08710Help
Entry
BOQ54_08710       CDS       T04583                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdq  Chelatococcus daeguensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOQ54_08710
  Lipid metabolism
   00071 Fatty acid degradation
    BOQ54_08710
  Amino acid metabolism
   00350 Tyrosine metabolism
    BOQ54_08710
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BOQ54_08710
   00626 Naphthalene degradation
    BOQ54_08710
Enzymes [BR:cdq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BOQ54_08710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1838982..1840004)
Genome map
AA seq 340 aa AA seqDB search
MPKMKAAIARVFGEPLAIEEWTVPEPRPDQILVKIAATGVCHTDLHAVKGDWPVKPTLPF
IPGHEGVGTVAAVGRDVKRVKEGDRVGVPWLHTACGYCPHCRTGWETLCGSQQNTGYSVN
GSFAEYALADPNYVGRLPENLAWGPAAPVLCAGVTVYKGLKETEVKPGEWVAISGIGGLG
HMAVQYARAMGMHVAAIDVHPDKLELARSLGAEIAIDARERDPVSELQQRIGGVHGVLVT
AVSPAAFEQAFGVLRPHGTMALVGLPPGRFAMPIFDTVLKRITVRGSIVGTRQDLEEALA
FAGDGAVAAHFSWDRLDNINDVFERMEAGAIDGRVVLDLA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatgaaagccgccatagcgcgggtgttcggcgagcctctcgccatcgaggaa
tggacggtgccggagccgcggccggaccagatcctcgtcaagatcgcggcgacgggcgtc
tgccacaccgacctgcacgcggtgaagggcgactggccggtcaagccgacgcttccgttc
attcctggccacgagggcgtgggcacggttgccgctgtggggcgcgacgtgaagcgcgtg
aaggagggcgaccgtgtcggcgtgccctggctgcacacggcctgcggctactgcccccat
tgccgcaccggctgggagacgctatgcggcagccagcagaacaccggctattccgtcaac
ggcagcttcgccgaatatgccctcgctgacccgaactacgtcggccggctgcctgaaaac
ctcgcctggggaccggccgcgccggtgctctgcgccggggttaccgtctacaagggcctc
aaggagacggaggtgaagcccggcgaatgggtggcgatctccggcatcggcgggctcggc
cacatggccgtgcaatatgcgcgcgccatgggcatgcatgtcgccgccatcgacgtgcat
cccgacaagctggaactcgccaggtcgctgggcgcggagattgccatcgacgcccgcgag
cgcgaccctgtttcggagctgcagcagcgcatcggcggcgtgcatggtgtcctcgtgacg
gcggtgtcgcccgctgccttcgagcaggctttcggcgtgctgcgtccgcacggcacgatg
gccctcgtcggcctgccgccgggccgtttcgcgatgccgatcttcgacacggtgctgaag
cgcatcacggtacgcggctccatcgtcggcacgcgccaggacctcgaggaggcgcttgcc
ttcgccggcgacggcgccgtcgcggcccatttttcctgggaccggctcgacaacatcaac
gacgtcttcgagcgcatggaagccggcgccatcgacggccgggtcgtcctcgacctcgcc
tga

DBGET integrated database retrieval system