KEGG   Chelatococcus daeguensis: BOQ54_11450Help
Entry
BOQ54_11450       CDS       T04583                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cdq  Chelatococcus daeguensis
Brite
Translation factors [BR:cdq03012]
 Eukaryotic Type
  Elongation factors
   BOQ54_11450
 Prokaryotic Type
   BOQ54_11450
Mitochondrial biogenesis [BR:cdq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BOQ54_11450
Exosome [BR:cdq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BOQ54_11450
  Exosomal proteins of breast cancer cells
   BOQ54_11450
  Exosomal proteins of colorectal cancer cells
   BOQ54_11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2428978..2430168)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAEKGGASFTAYDQIDKAPEEKARG
ITISTSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSSADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDPELLDLVELEVRELLSKYDFPGDDIPIIKGSALCALE
DRNPEIGRDAVLKLMDAVDAYIPQPERPKDQPFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEVEIVGLRPTQKTTVTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGMVKLPEGTEMVMPGDNVA
MEVELIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaagtttgagcgcacgaagccgcactgcaacatcgggacgattggtcac
gttgaccatggcaagacgtctctgacggcggcgatcacgaaggttcttgcggagaagggc
ggagcgtcgttcacggcgtacgaccagatcgacaaggcgcctgaggagaaggcgcgcggg
atcacgatctcgacgtcgcatgtcgagtacgagacggacaagcggcactatgcgcacgtg
gactgcccgggccacgcggactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgattcttgtggtttcgtcggctgacgggccgatgccgcagacgcgcgagcacatc
ctgctggcgcgtcaggttggcgtgccggcgcttgtggtgttcatgaacaaggtcgacatg
gtggacgaccccgagcttcttgatcttgtggagcttgaggtgcgcgagcttctgtcgaag
tacgacttccccggggatgacatcccgatcatcaagggctcggcgctgtgcgcgctggag
gaccgcaatccggagatcgggcgggacgctgttctgaagctgatggatgcggttgacgcg
tacatcccgcagccggagcgtccgaaggaccagccgttcctgatgccggttgaggacgtg
ttctcgatttcgggccgcgggacggtggtgacggggcgtgtggagcgcggcgtgatcaag
gtcggcgaggaagtcgagattgttgggctgcgtccgacgcagaagacgacggtgacgggc
gttgagatgttccgcaagctgctcgatcagggcgaggcgggggacaacatcggggcgctg
ctgcgcgggacgaagcgcgaggacgtggagcgcggccaggttctgtgcaagccgggctcg
gtgaagccgcacacgaagttcaaggccgaggcgtacatcctgacgaaggaagagggtggc
cgtcacacgccgttcttcaacaactaccgcccgcagttttacttccgcacgacggacgtg
acggggatggtgaagctgcccgagggcactgagatggtgatgccgggcgacaacgtggcg
atggaggtcgagctgatcgtcccgatcgccatggaggagaagctgcgcttcgccatccgc
gagggtggccgcacggttggcgccggcgtcgtcgcctccatcatcgagtaa

DBGET integrated database retrieval system