KEGG   Corynebacterium diphtheriae HC01: CDHC01_2008Help
Entry
CDHC01_2008       CDS       T01693                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00010  Glycolysis / Gluconeogenesis
cdt00071  Fatty acid degradation
cdt00350  Tyrosine metabolism
cdt00625  Chloroalkane and chloroalkene degradation
cdt00626  Naphthalene degradation
cdt01100  Metabolic pathways
cdt01110  Biosynthesis of secondary metabolites
cdt01120  Microbial metabolism in diverse environments
cdt01130  Biosynthesis of antibiotics
cdt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC01_2008 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CDHC01_2008 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CDHC01_2008 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDHC01_2008 (adhA)
   00626 Naphthalene degradation
    CDHC01_2008 (adhA)
Enzymes [BR:cdt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDHC01_2008 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: AEX75249
LinkDB All DBs
Position
complement(2119510..2120550)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGRETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPAEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgcagttgtggacaagtttggctcc
gagctcaacatccacgacgttgacctcccagagccaggccaacaccaagcactggtcaag
gtgctcacctccggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccatgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcatagcgttgcgctgggtgacatggtcggtaacgtctggctctggtcagcc
tgtggcgagtgcgagtactgtcgcaccggccgggagactatgtgcgagaaagccgagtac
ggcggatacaccgtcgatggttccttcggacagtacatgctggtagacacccgttactgt
gcccgaatcccagacggctgtgacctgctggaagtcgccccaattctgtgcgctggcgtg
accgtgtacaaaggcctcaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgataagctcgaactggctaagaagcatggcgctgagttt
gtggtcaatgcccgcgaagaagacccagctgaggcaattgtgaagtacaccaagggtggc
gcacatggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
atcttcgacatcgttttcaagggcctgaccatccgcggctccctcgtaggtacgcgccaa
gaccttgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacggc
cgcatggctatccgctactag

DBGET integrated database retrieval system