KEGG   Candida dubliniensis: CD36_10760Help
Entry
CD36_10760        CDS       T01140                                 

Definition
(RefSeq) glutamate decarboxylase, putative
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cdu  Candida dubliniensis
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CD36_10760
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CD36_10760
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CD36_10760
   00430 Taurine and hypotaurine metabolism
    CD36_10760
Enzymes [BR:cdu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CD36_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(2551506..2553212)
Genome map
AA seq 568 aa AA seqDB search
MVLSKHIDALRLETQILKKTPQAQLRKDQFIDAFDSHKNIPQFEIPQNSSNEQLIYKYLS
QELSLDGVPTLNLASFVNTYVDGTSLKLIEDNLTKNLADNDEYPSLIDIQTRCISILSNL
WGAPGKVDNVTGNRVTNSIGTATTGSSEAIMLAGLALKKRWQLKRKAEGKSTANPNILMA
TCAQVALEKFACYFDVENRLIPVTEESGHLIDVSKIKENIDENTIGIFVIMGSTFTGAFE
PVEEISKLLDEVEKERGLDIRIHVDGASGGFVAPFIFPHLKWDFAVSRVDSINTSGHKFG
LTSVGLGWVIWKDADLLPKELRFSLDYLGGVEETFGLNFSRPGFPVITQYYNFLTLGRQG
YAKIFDGCMTNARLLSEFLEESKYFEVVSVIHHKLSESERKAQFTREVDDKHLDSKLYTI
NEDFKPGLPVVAFRFSKEFRDKYPELPQELLSTLLRKRGYIIPNYHLPPSENDKEILRVV
VRNSLSLNLLERLIQDITDATELLIKAADSITDYVSTSGEHTDVENRERIHKLLAAIASG
GVSEAKEEKHKKDNHKSGKNKKSYRGTC
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggttttaagtaaacacattgatgcattgagattggaaacgcaaattttgaagaaaact
ccacaagcccaattgcgtaaagatcaattcattgatgcatttgattcccacaagaacatt
cctcaatttgaaatcccacaaaactcatcaaatgaacaattgatttataaatatctttcc
caagaattatctcttgatggggtccccacattgaatttggcctcgttcgttaacacctat
gttgatggtacatctttgaaattaatcgaagataacttaaccaaaaacttggcggataac
gacgagtacccaagcttgatagatatacaaaccagatgtatatctattttaagcaacttg
tggggtgcccctgggaaagtagataatgtaactggtaaccgagtaactaattctattggt
acagccacaactggttcatctgaagctataatgttagctggattggctttgaagaaaaga
tggcaattgaaaagaaaagctgaaggtaaatctactgccaatccaaatatcttgatggct
acatgtgctcaagtcgccttggaaaaatttgcttgttattttgatgtagaaaacagatta
attcctgtcaccgaagaatctggtcatttgattgatgtttccaaaatcaaggaaaatatt
gatgaaaacacaattggcatttttgtaattatgggatctacctttactggtgcatttgag
cctgttgaagaaatttcgaaattattagatgaagttgaaaaagaacgtggattggatatc
agaattcatgttgatggagcatcgggtggatttgttgcaccatttattttcccccatttg
aaatgggattttgctgtctctagagttgattcgattaatacctctggtcacaagtttggg
ttgacttctgttggtttgggttgggtgatctggaaagatgctgatttgttgcccaaagag
ttgcgttttagtttggattatctcggtggtgttgaagaaacatttggcttaaatttctct
agacctggtttccctgtcattacccaatactacaactttttaactttaggcagacaaggg
tatgccaaaatctttgatgggtgcatgaccaatgctaggttgttgtcggaatttttggag
gaaagtaaatattttgaggttgtctcggttattcaccataaattgagtgaatcagaaaga
aaagctcaattcactagagaagtcgatgacaaacatttggattctaagctttatactatt
aatgaagatttcaagcctggtttgcctgtagttgcattcagattctccaaagagtttaga
gacaagtaccctgaattgcctcaagaattgttgtcaacattgttaagaaaaagaggttat
attattccaaactaccacttgcctccatctgagaacgacaaggagattttgagagttgtt
gttcgtaactcgttatctttgaatttgttggagagattaattcaagacatcactgatgct
accgaacttttgatcaaagctgctgattccattactgattatgtttcaacaagtggtgag
cacactgatgttgaaaatagagaaagaattcataagttattggctgctattgcctctggt
ggtgtttctgaagccaaagaagaaaaacacaagaaggataatcacaaatccgggaagaat
aaaaagtcttatcgtggtacttgttag

DBGET integrated database retrieval system