KEGG   Candida dubliniensis: CD36_29870Help
Entry
CD36_29870        CDS       T01140                                 

Definition
(RefSeq) hexokinase-2, putative
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_29870
   00051 Fructose and mannose metabolism
    CD36_29870
   00052 Galactose metabolism
    CD36_29870
   00500 Starch and sucrose metabolism
    CD36_29870
   00520 Amino sugar and nucleotide sugar metabolism
    CD36_29870
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CD36_29870
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CD36_29870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
R:984790..986244
Genome map
AA seq 484 aa AA seqDB search
MVHLGPKPAQKRKGTFTDVSPQLLDALKPIQEQFTISADTLRAIVKHFISELDRGLSKAG
GNIPMIPGWVMDFPTGKETGSYIAIDLGGTNLRVVLVKLGGNRDFDTTQSKFALPPHMRT
ATSDELWDFIAKCLKDFVDEIYPDGCTEPLPLGFTFSYPASQSRINEGILQRWTKGWAID
GIEGKDVVPMLQKAIKKVGVPINVVALINDTTGTLVASMYTDPEAKMGLIFGTGVNGAYF
DVVKDIPKLEGKCPADIPPESPMAINCEYGSFDNEKYILPRTKYDVQIDEESPRPGQQTF
EKMISGYYLGEVLRLILLEFAEEKKLIFKGQNIDKLKIPYVMDASYPSRIEEDPFENLSD
VADLFREKLGIETTEPERKIIRRLAELIGERSARFSVCGIAAICQKRGYETAHCAADGSV
YNKYPGFKERTAQALRDIYEWPADIKDPIIIVPAEDGSGVGAAIIAALTEKRLREGKSVG
LLEA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatctcggtccaaaacctgctcagaaaagaaagggaactttcactgatgtttct
cctcaattattagacgctcttaaaccaattcaagagcaatttactatttctgcagacaca
ttaagagccattgtcaaacatttcatctcagaattagaccgtggtttatcaaaagctggt
ggtaacattcctatgattcctggttgggtcatggatttcccaactggtaaggaaactggt
tcttatattgccattgacttgggtggaaccaacttgagagttgtcttggtaaaattaggc
ggtaatagagattttgacactactcaatccaaatttgctttgccacctcacatgagaact
gccaccctggacgaattgtgggattttattgctaaatgtttgaaagattttgttgatgaa
atctacccagacggctgcactgaaccattgccattgggtttcacattcagttacccagct
tcccaaagccgtatcaatgaaggtattttgcaaagatggactaaaggttgggccattgat
ggaattgaaggaaaagatgttgtcccaatgttgcaaaaagccattaagaaagttggcgtg
ccaattaatgttgttgcattgattaacgataccactggtacattagtcgcttccatgtat
actgacccagaagctaagatgggtttgattttcggtactggtgtcaatggtgcttatttc
gatgttgtcaaggatattcctaaattggaaggtaaatgtccagcagatattccaccagaa
tcaccaatggccatcaactgtgaatacggttcatttgataatgaaaagtatatcttacca
agaactaaatatgatgttcaaattgacgaggagtcaccaagaccaggtcaacaaactttc
gaaaagatgatctctggttactatttgggagaagttttgagattgattttattagaattt
gctgaagagaagaaattgatctttaaaggtcaaaacattgacaaattgaagatcccatat
gttatggatgcttcctacccatcaagaatcgaagaagatccatttgaaaacttgtctgat
gtcgcagacttgtttagagaaaaattaggtattgaaaccacagaaccagaaagaaagatc
attcgtcgtttggctgaattgattggtgaaagatctgctagattctctgtttgtggtatt
gctgccatttgtcaaaagagaggttatgaaactgctcattgtgctgctgacggttcagtg
tacaacaagtacccaggattcaaagaaagaactgctcaagctttaagagacatctatgaa
tggccagcagatattaaggatccaatcatcattgttccagccgaagatggtagtggtgtt
ggtgctgctattattgctgctttgacagaaaagagattgagagaaggaaaatccgttggt
ttgttagaggcttag

DBGET integrated database retrieval system