KEGG   Candida dubliniensis: CD36_62130Help
Entry
CD36_62130        CDS       T01140                                 

Definition
(RefSeq) NAD-dependent glycerol-3-phosphate dehydrogenase, putative
  KO
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
cdu  Candida dubliniensis
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CD36_62130
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CD36_62130
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     CD36_62130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6:complement(425672..426787)
Genome map
AA seq 371 aa AA seqDB search
MTTSPYPIETPFRVCIVGSGNWGTAVAKLVAENCAEKPTIFQNDVKMWVFEEEIEGRKLT
EIINTDHENVKYLPEVKLPANLVANPDIVDTVKDADLIVFNIPHQFLSRIVKQIEGKVKP
TARAISCLKGLDVSPEGCKLLSTSITDTLKIYCGVLSGANIANEVARGNWSETSIAYTVP
DDFRGAGKDIDPFILKEAFHRPYFHVRVIEDVVGASIAGALKNVIACSVGFVEGAGWGDN
AKAAIMRIGIKETIRFASYWELFKIKASSPPNPRTFTEESAGVADLITTCSGGRNVKVAR
YMIKNNVNAFEAEKIVLNGQSSQGILTAKEVHELLTHFNIQDEFPLLEATYKVIYENGSV
DDFPQLLEGDQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgactacatctccatatccaattgaaactccattcagagtttgtattgtcggttccggt
aactggggtactgcagttgcaaagttagttgctgaaaactgtgctgaaaaaccaactatt
ttccaaaacgatgtcaaaatgtgggttttcgaagaagaaattgaaggaagaaaattaaca
gaaataattaacactgatcatgaaaatgtcaaatacttgccagaggttaaattgccagcc
aacttggttgccaacccagatattgtcgacactgttaaagacgccgacttgattgttttc
aacatcccacatcaattcttgagtagaattgttaaacaaattgaaggtaaagtgaaacca
actgccagagccatctcatgtttgaaaggattagatgtgagtccagaaggttgcaaattg
ttgtcaacatccatcactgatactttgaaaatatactgtggtgttttatctggtgccaat
attgctaatgaggttgccagaggtaactggtcagaaacttcaattgcctacactgttcca
gatgatttcagaggtgccggtaaagacattgatccatttattttgaaggaagctttccac
agaccatattttcacgtcagagtcattgaagatgttgttggtgcctctattgctggtgcc
ttgaagaatgtcattgcgtgctctgttggtttcgttgaaggtgctggctggggtgacaat
gctaaagccgctatcatgagaattggtatcaaggaaaccattcgttttgcatcatactgg
gaattgttcaagatcaaagcctcgtctccaccaaacccaagaacatttactgaagaaagt
gccggtgttgctgatttgatcactacttgttctggtggtagaaatgttaaagtcgccaga
tatatgattaaaaataacgtcaatgcatttgaagctgaaaagattgttttgaatggacaa
agctcccaaggtattttgactgcaaaagaagtgcacgaattgttaacacatttcaacatc
caagatgaattcccattactcgaagctacctacaaggttatctacgaaaatggcagtgtc
gatgatttcccacaattattagaaggtgatcaataa

DBGET integrated database retrieval system