KEGG   Corynebacterium diphtheriae 31A: CD31A_0568Help
Entry
CD31A_0568        CDS       T01697                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CD31A_0568 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CD31A_0568 (alr)
Enzymes [BR:cdz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CD31A_0568 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cdz01011]
 Precursor biosynthesis
  Racemase
   CD31A_0568 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
563359..564507
Genome map
AA seq 382 aa AA seqDB search
MNLLETRISCDAIAANTRRLKDMVAPAQLMCVVKADGYNHGAPEVATVMARNGADQFGVA
TLAEAHQLRDAGITLPILCWIWSPEQDFSAAIDRDIDLAAVSMDHVRALIAEAVRRPAGT
RVRVTVKIDTELHRSGIDEANWTEAFELLHACPQVNVTGVFSHLACADDLESDYTDHQAE
VFRRAIAAGRCVGLDLSVNHLAASPATLTRPDLHFDMVRPGLALYGHEPIAGLDHGLREA
MTWIGSVTVVKPIAAGQGTSYNMTWHAPADGYLCVVPVGYADGLPRNVQGHLEVTIAGTR
YPQVGRVCMDQIVVFLGDNSRGVAPGDKAIIFGPRETQAMTATELACATGTINYEILCRP
TGRSHRTYSDFDAVAPTHPTES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcgaaactcgcatctcgtgcgacgccattgctgcgaacacgcgacgttta
aaagacatggttgctcccgctcagctcatgtgtgtagtaaaagctgacggctacaatcac
ggtgccccagaagttgctactgtgatggcgcgtaacggtgccgaccaatttggtgtggca
acgcttgcggaagcacatcagctacgagacgcgggtatcactctccccatcctgtgctgg
atctggtcacccgagcaggacttttccgccgccattgaccgtgacatcgacttagccgcc
gtcagcatggatcacgttcgtgcactgatcgcagaggctgtgcgtcgtcccgcaggtacc
cgagtgcgggtgaccgtgaaaattgacacggaacttcaccgatctggaattgacgaagca
aactggacagaagcctttgagcttcttcatgcttgcccccaagtcaacgtcacgggcgta
tttagtcacttggcatgcgcagacgacttggaatcggactacaccgaccaccaagcagaa
gtattccgtagggcgattgctgcaggtagatgcgtaggacttgacctttctgttaatcat
ctagcggcatcaccagcaacactaacccgccccgacttgcactttgacatggtccggcct
gggcttgccctctatggtcacgagccgatagcagggctcgaccatgggctgcgcgaagcc
atgacatggattggttcagtaacagtggtcaaacccatcgcggcaggccaaggaaccagc
tacaacatgacatggcatgcgcccgcagatggctacctctgcgtggtgccggtgggctat
gcggacggattaccgcgcaacgtacaaggacatttagaagtaacgatcgccggcacgcgc
tacccacaagtagggcgcgtttgtatggaccagattgtggtattccttggcgataattcc
cgcggcgttgcccctggtgataaggcaattatttttggcccacgtgaaacccaagcgatg
accgccacggagctggcctgcgctacgggaaccatcaactatgaaatcttgtgccgcccg
accggacgaagccatagaacctatagtgattttgacgccgttgcgcccacgcaccctact
gaaagctga

DBGET integrated database retrieval system