KEGG   Corynebacterium diphtheriae 31A: CD31A_1569Help
Entry
CD31A_1569        CDS       T01697                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD31A_1569 (pyk)
   01230 Biosynthesis of amino acids
    CD31A_1569 (pyk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD31A_1569 (pyk)
   00620 Pyruvate metabolism
    CD31A_1569 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    CD31A_1569 (pyk)
Enzymes [BR:cdz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     CD31A_1569 (pyk)
Exosome [BR:cdz04147]
 Exosomal proteins
  Proteins found in most exosomes
   CD31A_1569 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1620256..1621677)
Genome map
AA seq 473 aa AA seqDB search
MERRTKIVCTLGPAVASREGILGLVKAGMNVARMNMSHGDHADHEKNYQWVREATDETGR
AVGILADLQGPKIRLGRFIDGATVWENGEIVRITVDDIEGTHDRVSTTYKNLAKDAKPGD
RLLVDDGKVALRCVEVDGNDVVCEVVEGGPVSNNKGVSLPGMDISVPALSEKDIADLRFA
LKLGVDIIALSFVRSPADVELVHAIMDEEGRRCPVIAKLEKPEAMDALESIVLAFDGIMI
ARGDLGVECPLEQVPLFQKRAIQIARENAKPVIVATQMLDSMIENLRPTRAEASDVANAV
LDGADAVMLSGETSVGIDPANVVRTMSRIVSYAEIDGRVPNLAHIPRTKRGVISYSARDI
AERLNAKALVAFTSSGDTAKRVARLHSQLPLLVFTPHQEVRSQLALTWGVETFLTDEVKD
TDEMMRTIDEQLLALDTYSEDDMIVLVAGTPPGVQGNTNMIHVHHLGEDLNGL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtcgaactaagattgtttgtacattagggccggcagtcgcttcccgtgaggga
attcttggactggttaaagccggcatgaatgtcgcgcgtatgaatatgtcacacggcgac
cacgcagatcatgagaagaattaccagtgggtccgcgaagctacggatgaaaccggacgc
gctgttggtattcttgccgatctgcaggggccaaagattcgtctcggtcgctttatcgat
ggcgcaacggtgtgggagaacggtgaaatcgttcgtatcactgttgatgacattgaaggt
acacacgaccgtgtgtctaccacctacaagaacctcgctaaagatgcgaagcctggcgat
cgtcttttggtcgacgacggcaaggttgcattgcgctgtgttgaagtagatggaaacgat
gttgtttgtgaggtcgtagaaggcggcccagtttctaacaacaagggtgtttcccttcct
ggaatggatatttccgttccagctttgtctgaaaaagacattgctgatttgcgcttcgct
ctcaagctcggtgttgacattatcgcgttgtccttcgtccgctccccagcagacgtggaa
cttgttcatgccatcatggatgaagaaggtcgccgttgcccagtgatcgcaaagcttgag
aagccagaagctatggacgctttggaatccatcgtactggctttcgacggcatcatgatt
gctcgcggtgacttgggtgttgagtgcccgttggagcaggtgccgctgttccagaagcgt
gccatccagattgctcgtgaaaacgctaagcctgtgattgtggcaacccaaatgctcgat
tccatgatcgagaacctacgcccaacccgtgctgaggcttctgacgtagctaacgctgtt
cttgacggtgcagatgccgttatgctgtccggtgagacttcggtcggtatcgatccagct
aacgttgtccgtactatgtcacgtatcgtttcctacgctgagattgatggccgcgtacca
aacttggctcatattccacgcaccaagcgtggcgtgatttcctactctgcacgcgacatt
gcagagcgtttgaatgcaaaggcacttgtagcattcacctcttcaggtgatactgcaaag
cgtgttgctcgtttgcactcgcagctgccgctattggtctttacccctcaccaagaagtc
cgctctcagttggctttgacttggggtgtagaaaccttccttaccgacgaggttaaggac
acagacgagatgatgcgtacgatcgatgaacagttgcttgctctcgatacctacagcgaa
gatgacatgatcgtgctcgtagccggaacccctccaggagtccaaggcaataccaacatg
atccatgtacaccacctaggtgaggacctcaacggtctataa

DBGET integrated database retrieval system