KEGG   Cellvibrio sp. PSBB023: B0D95_17050Help
Entry
B0D95_17050       CDS       T04725                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:ceb00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    B0D95_17050
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    B0D95_17050
Transporters [BR:ceb02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    B0D95_17050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3971438..3972238)
Genome map
AA seq 266 aa AA seqDB search
MSLRLKNLGNYLTVRVVPALVVIGILVAIWQITCSRPDSNLPSATTVFEETRYLIENPFY
DNGGTDVGMGWQLLASLKRVAIGYTLAVIAGVALGILVGQSVWAMRGLDPLFQVLRTVPP
LAWLPLSLAGFQDSQPSALFVIFITSIWPIIINTSVGVRNIPADYRNVARVVRLNGWQYF
YKIMLPAAAPYIFSGLRIGIGLSWLAIIAAEMLVGGVGIGFFIWDAWNSSRISDIILALI
YVGLVGYALDRLVSLAGYFVTRGTGQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgtcactgcgcctcaaaaatctgggcaattacctgacagtgcgggttgttcccgcgctg
gtggtgattgggattctggtcgcgatttggcaaattacctgctcgcgccccgattccaat
ttgccttccgccaccaccgtgtttgaagagacgcgctatttaattgagaacccgttttat
gacaacggcggcactgacgttggtatgggctggcaattattggcaagcctcaagcgtgtg
gccatcggttataccctggcggtgattgcaggcgtagcactgggtattttagtggggcaa
tccgtatgggcgatgcgcggacttgacccgctgtttcaagtcctgcgtacggtgccgccg
ctggcttggctgccgctgtcgctcgccggttttcaggacagccaaccctctgccctgttt
gtgatttttattacgtcgatttggcccatcatcattaacacctcggtgggtgtacgcaat
attccggcggactatcgcaatgtggcgcgcgtggtgcgcttaaatggctggcaatatttt
tacaaaattatgctgccggctgctgcgccttatattttctccggcttgcgtattggtatt
ggtttgtcgtggttggccattatcgctgccgaaatgttggtgggcggtgtggggattggt
ttctttatttgggatgcctggaattcatcgcgcatcagcgacattattctcgcgctgatt
tacgttggcttggtgggttatgccctggatcgcttggtatcactggccggttattttgtg
acgcgcggtaccgggcaataa

DBGET integrated database retrieval system