KEGG   Corynebacterium efficiens: CE1703Help
Entry
CE1703            CDS       T00103                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cef  Corynebacterium efficiens
Pathway
cef00620  Pyruvate metabolism
cef00680  Methane metabolism
cef01100  Metabolic pathways
cef01120  Microbial metabolism in diverse environments
cef01200  Carbon metabolism
Module
cef_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CE1703
  Energy metabolism
   00680 Methane metabolism
    CE1703
Enzymes [BR:cef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CE1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAC18513
NITE: CE1703
UniProt: Q8RQL3
LinkDB All DBs
Position
complement(1792342..1795101)
Genome map
AA seq 919 aa AA seqDB search
MNELLRDDIRYLGRILGEVISEQEGHHVFELVERARRTSFDIAKGRAEMDSLVEVFAGID
PEDATPVARAFTHFALLANLAEDLHDAAQREQALNSGEPAPDSTLEATWVKLDDAGVGSG
EVAAVIRNALVAPVLTAHPTETRRRTVFDAQKHITALMEERHLLLALPTHARTQSKLDDI
ERNIRRRITILWQTALIRVARPRIEDEVEVGLRYYKLSLLAEIPRINHDVTVELARRFGG
DIPTTAMVRPGSWIGGDHDGNPFVTAETVTYATHRAAETVLKYYVKQLHALEHELSLSDR
MNVISDELRVLADAGQNDMPSRVDEPYRRAIHGMRGRMLATTAALIGEEAVEGTWFKTFT
PYTDTHEFKRDLDIVDGSLRMSRDDIIADDRLAMLRSALDSFGFNLYSLDLRQNSDGFED
VLTELFATAQTEKNYRGLTEAEKLDLLIRELSTPRPLIPHGDPDYSEATNRELGIFSKAA
EAVRKFGPLMVPHCIISMASSVTDILEPMVLLKEFGLIRANGKNPTGSVDVIPLFETIDD
LQRGAGILEELWDIDLYRNYLEQRDNVQEVMLGYSDSNKDGGYFAANWALYDAELRLVEL
CRGRNVKLRLFHGRGGTVGRGGGPSYDAILAQPKGAVRGAVRVTEQGEIISAKYGNPDTA
RRNLEALVSATLEASLLDDVELPNRERAHQIMGEISELSFRRYSSLVHEDPGFIQYFTQS
TPLQEIGSLNIGSRPSSRKQTNTVEDLRAIPWVLSWSQSRVMLPGWFGVGTALREWIGEG
EGAAERIAELQELNRCWPFFTSVLDNMAQVMSKAELRLARLYADLIPDREVADRIYETIF
GEYFLTKEMFCTITGSQDLLDDNPALARSVRSRFPYLLPLNVIQVEMMRRYRSGDEGTAV
PRNIRLTMNGLSTALRNSG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaacttctccgtgacgatatccgttatctcggccggatcctgggcgaggtgatc
tccgagcaggagggccaccatgtcttcgaactggttgaacgcgcccgccggacctccttc
gacatcgccaagggacgcgcggagatggacagtctggtggaggtgttcgctggcatcgac
ccggaggacgccacgcccgtggcccgagccttcacccatttcgccctgttggccaacctc
gcggaggatttgcatgacgcagcccagcgggaacaggccctgaactcgggtgagcccgcg
ccggacagcaccctcgaggccacctgggtgaaactggatgatgccggggtgggcagcggt
gaggtcgccgcggtgatccgcaatgcgctcgtcgccccggtgctcaccgcgcacccgacg
gaaacccgacgtcgtaccgtgttcgacgcgcagaagcacatcaccgccctgatggaggaa
cgccacctcctcctggcgctgcccacgcatgcccggacccagtccaagctggatgacatc
gagcgcaacatccggcgacggatcacgatcctgtggcagacggccctcatccgtgtggcc
cgtccccgcatcgaggatgaggtcgaggttggactgcgctactacaagctcagcctgttg
gccgagatcccccgcatcaatcatgatgtgaccgtggaactggcccggcgtttcggcggg
gatatccccaccacggcgatggtcaggccgggatcctggatcggcggggaccatgatggc
aaccccttcgtcaccgcggagactgtcacctacgccacccatcgggccgcggagaccgtg
ctcaagtactacgtcaagcaactgcacgccctggaacacgaactcagtctctccgaccgg
atgaacgtcatcagcgatgagctgcgtgtgcttgccgatgccggccagaatgacatgccc
agccgggttgatgaaccctaccggcgggccatccacggcatgcgtggccggatgctggcc
accacggccgccctgatcggtgaggaggcggtcgagggcacctggttcaagaccttcacg
ccctataccgatacccacgagttcaaacgcgacctcgatatcgtggatggttccctgaga
atgtcccgggatgacatcatcgccgatgaccgtctggccatgctgcgctcggccctggac
agcttcgggttcaacctctactccctggatctgcgccagaattccgacggtttcgaggat
gtcctcaccgaattgttcgccaccgcccagaccgagaagaactaccgcgggttgacggag
gcggagaagctggacctgctgatccgcgaactgagcacaccccgcccgctcatcccgcac
ggggacccggactactccgaggccaccaaccgtgaactggggattttttcgaaggccgcg
gaggccgtgcgtaaattcggtcctctcatggtgccgcactgcatcatctccatggcctct
tccgtcacggacatcctcgaaccgatggtgctgctcaaggagttcggtctgatccgggcc
aacgggaagaacccgacgggcagcgtcgacgtgatcccgctgttcgagacgatcgatgac
ctccagcgtggcgcgggcatcctggaggaattgtgggacatcgacctctaccgcaattac
cttgagcagcgggacaacgtccaggaggtcatgctggggtattccgactccaacaaggac
ggcgggtacttcgccgccaactgggcgctttacgacgcggagttacgcctggtcgaacta
tgccggggccgtaatgtcaagctccgtctcttccacggtcgtggtggcacggtgggtcgt
ggcggtggcccctcctatgatgcgatcctggcccagcccaagggcgcggtccggggtgcg
gtgcgggtgactgaacagggcgagatcatctccgcgaagtacggtaacccggatacggca
cgccgcaaccttgaggccctggtgtccgcgacgctggaggcatcgcttctggatgatgtg
gaactgcccaatcgggaacgcgcgcaccagatcatgggggagatctcggagttgagcttc
cgcaggtactcatcactggtccatgaggatcccggattcatccagtacttcacccagtcc
acccccctgcaggagatcggatccctcaacatcggttcccgaccctcctcacgtaaacag
accaacacggtggaggatctgcgtgccatcccgtgggtgctcagctggtcccagtcccgt
gtcatgctgccgggctggttcggtgtgggtaccgcactgcgtgagtggatcggtgagggg
gagggggctgcggagcgcatcgcggagctgcaggaactcaaccggtgctggccgttcttc
acctcggtgctggacaacatggcccaggtgatgagcaaggcggaactgcgcctggccagg
ttgtacgccgatctcatcccggatcgcgaggtggcggaccggatctatgagaccatcttc
ggggagtatttcctgaccaaggagatgttctgcaccatcaccggttcccaggacctgctc
gatgacaacccggcgctggcgcgatcggtgcgcagtcggttcccgtacctgctgccgctc
aatgtcatccaggtggagatgatgcgccggtaccggtccggtgatgagggcacggctgtc
ccacgtaatatccgcctgaccatgaatggattgtccacggccctgcgcaactcgggttag

DBGET integrated database retrieval system