KEGG   Celeribacter ethanolicus: CEW89_14965Help
Entry
CEW89_14965       CDS       T05094                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ceh  Celeribacter ethanolicus
Brite
Translation factors [BR:ceh03012]
 Eukaryotic Type
  Elongation factors
   CEW89_14965 (tuf)
 Prokaryotic Type
   CEW89_14965 (tuf)
Mitochondrial biogenesis [BR:ceh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CEW89_14965 (tuf)
Exosome [BR:ceh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CEW89_14965 (tuf)
  Exosomal proteins of breast cancer cells
   CEW89_14965 (tuf)
  Exosomal proteins of colorectal cancer cells
   CEW89_14965 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ATG48749
UniProt: A0A291GFH6
LinkDB All DBs
Position
3043509..3044684
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGDFKAYDEIDGAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVNAADGPMPQTREHILLARQ
VGVPALVVFLNKVDQVDDEELLELVEMEVRELLSEYDFPGDDIPIIAGSALAALEGRDPE
IGENKIRELMEAVDAYIPEPERAIDQPFLMPIEDVFSISGRGTVVTGRVERGVINVGDEI
EIVGIRDTKKTTCTGVEMFRKLLDRGEAGDNIGALLRGVDREGVERGQVLCKPGSVNPHT
KFESEVYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVVLPEGTEMVMPGDNLKFTVEL
IAPIAMEEGLRFAIREGGRTVGSGVVSKIIA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggtaagtttgagcgtaacaaaccgcacgtcaacatcggcacgatcggccac
gttgaccacggcaagaccactctgacggcagcgatcaccaagtacttcggtgacttcaaa
gcctatgacgaaatcgacggtgcgccggaagagaaagcccgcgggatcacgatctccacg
gcccacgtggaatacgagaccccgaaccgccactacgcgcacgtcgactgccccggccac
gccgactacgtgaagaacatgatcaccggtgcggcccagatggacggcggtatcctggtt
gtgaacgcggctgacggtccgatgccgcagacccgtgagcacatcctgctggcccgtcag
gtcggcgtgccggctctggttgtgttcctgaacaaagtggaccaggtcgacgacgaagag
cttctggagctggtcgaaatggaagttcgcgaacttctgtccgaatacgacttcccgggc
gacgatattccgatcatcgcgggctccgctctggccgctctcgaaggtcgtgacccggaa
atcggcgagaacaagatccgcgaactgatggaagccgtcgacgcctatatcccggaaccc
gagcgtgcgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtgggactgttgtgaccggccgtgtggaacgcggtgtgatcaacgtgggcgacgagatc
gaaatcgtcggcatccgcgacaccaagaaaaccacctgtaccggtgttgaaatgttccgc
aaactgctcgaccgcggtgaagccggcgacaacatcggcgccctgctgcgcggtgtggac
cgtgaaggcgtcgagcgtggtcaggttctgtgtaaaccgggctccgtgaacccgcacacc
aaattcgaatccgaggtctacattctgaccaaggaagaaggtggccgtcacaccccgttc
ttcgcgaactaccgtccgcagttctacttccgtacgacggacgtgaccgggaccgttgtt
ctgccggaaggcacggagatggtgatgccgggcgacaacctgaaattcacggttgagctg
atcgccccgatcgcgatggaagaaggtcttcgcttcgccatccgcgaaggcggccgcacc
gtgggttcgggcgtggtgtccaaaatcatcgcctga

DBGET integrated database retrieval system