KEGG   Corynebacterium epidermidicanis: CEPID_01890Help
Entry
CEPID_01890       CDS       T03955                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
cei  Corynebacterium epidermidicanis
Brite
Translation factors [BR:cei03012]
 Eukaryotic Type
  Elongation factors
   CEPID_01890 (tuf)
 Prokaryotic Type
   CEPID_01890 (tuf)
Mitochondrial biogenesis [BR:cei03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CEPID_01890 (tuf)
Exosome [BR:cei04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CEPID_01890 (tuf)
  Exosomal proteins of breast cancer cells
   CEPID_01890 (tuf)
  Exosomal proteins of colorectal cancer cells
   CEPID_01890 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
388964..390154
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNQAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLGEQEFDEEAPIIHISALKAL
EGDEKWTQSILDLMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGSLKV
NEEVEILGIKEKSQTTTVTGIEMFRKLLDYTEAGDNCGLLLRGTKREDVERGQIVAKPGA
YTPHTEFEGSVYILSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGGRTVGAGRVTKITK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgcacgaaaccgcacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgacgcttac
ccagatctcaaccaggctttcgctttcgacgccatcgacaaggcaccggaagagaaggaa
cgtggcattacgattaacatttcccacgttgagtaccagaccgagaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgatcaccggcgcagctcag
atggacggcgcaatcctcgttgttgcagctaccgacggcccaatgcctcagacccgcgag
cacgttctgctcgctcgccaggttggcgttccttacatcctcgttgctctgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgttgagatggaagttcgtgaacttctc
ggtgagcaggagttcgacgaagaagctcctatcatccacatctccgctctgaaggctctc
gaaggcgacgagaagtggacccagtccatcctcgatctgatgcaggcttgtgacgacaac
atcccagacccagttcgcgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggccgtggcaccgttgttaccggtcgtgttgagcgcggctccctgaaggtc
aacgaggaagttgaaatcctcggcatcaaggaaaagtctcagaccaccaccgttaccggt
atcgaaatgttccgcaagctcctcgactacaccgaggctggcgacaactgtggtctgctg
ctccgcggcaccaagcgcgaagacgtcgagcgtggccagatcgtggctaagccaggcgct
tacacccctcacaccgagttcgagggctccgtctacatcctgtccaaggatgagggtggc
cgccacaccccattcttcgacaactaccgcccacagttctacttccgcaccaccgacgtt
accggtgttgtgaagctccctgagggcaccgagatggtcatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgaaggcctccgcttcgctatccgc
gaaggcggccgtaccgttggtgcaggtcgcgttaccaagatcaccaagtaa

DBGET integrated database retrieval system