KEGG   Corynebacterium epidermidicanis: CEPID_03560Help
Entry
CEPID_03560       CDS       T03955                                 

Definition
(GenBank) F5/8 type C domain-containing protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cei  Corynebacterium epidermidicanis
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cei00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CEPID_03560
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CEPID_03560
Enzymes [BR:cei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CEPID_03560
Bacterial toxins [BR:cei02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CEPID_03560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
718706..721414
Genome map
AA seq 902 aa AA seqDB search
MVHFPGRKKLGSVLASLSVAAASIAAPVYAAAQESGDQPSVNPALQEMSDPTALVEKIPG
VVNYRIPAITATPGGDLIAAFDERPISANDPNLGSTTGWNGQDWYRDLQSKWKDGGDAPN
PNSIAQYRSKDNGTTWEKDGYVCQGNPVGDWTKINGCSDPSYVVDWVTGEIFNFHVLSYQ
AGIQEAHVGNDHEDRFVIQVEVSRSKDDGKSWESETITKTVTPDPKVRWRFAASGQGIQI
RNGKHAGRLVQQFTQAKEGSTAQEAFSLYSDDHGATWHAGQPVGTEMDENKVVERADGSL
LLNSRERTGANRSRWQAESFDGGATWSKPWLATDIVDAMTNGQPIRAFPQATPEDPRSSI
LLFANAQIFQSYNRKKGTIWMSCDGGSTWPISKVFNEGSTGYATITVQNDGRIGMLTEDG
LGDSKESGIFYRSFGLGWLEQSCASMTASDVEGSAAGESVTIPAKIASTTGTVAGELTAV
GLPAGWTADPVHVSGEDGEIQLNIPESAIEGTYHISLRYVGDDGAVAAKAVQVSVVDDTR
VPRDHLVAVWANSNDGNPIGLAFDDNPATFWHSQWQNKPAELNNNHDIVVSLADEHDLTK
IGYLPPQRDQKNGAFKNYEVFVGQRGANASCADIGGWASVASGELAYERRYFSGISLDQE
AARQVDCLKIHVSGEHTGPSGTNASAAEIRLYGTKNAIVSPTPTVSTTTVTATTTETTTQ
QETVISTIYETETQEPVTITEPTTVTEPTTVTVTTTVAEPSRVTEPTTVTQPTTVTATHT
EPTTVTMTITVPTTSTERSTVTESTTITVPTTVNATVAEPTVLTTTTTVPTTVTAATTVT
TTVTVLPQVTTSTTSPAPTLELDHNQSGYKWGRVIAWLVAIGGGLLAMVPPLLNYLRTQG
FI
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggtgcattttcctggaaggaagaagctcgggagtgttctggcatccctgagcgtggcc
gccgcgagcattgcggcgcccgtgtatgcggctgcacaagaaagtggtgatcagccctcg
gtaaatccggcgttgcaagaaatgtcggatccgaccgcactggtggagaagatccccgga
gtggtcaactatcgtatccccgcgattacggcgacacccgggggtgacctgatcgccgca
ttcgatgaacgtcccatcagtgccaacgacccgaatctagggtcaacaaccggctggaac
gggcaagactggtaccgagatttgcagagcaagtggaaagacggtggagatgccccgaac
ccgaattccatcgcccagtatcggtcgaaagacaatggaactacctgggaaaaggatggc
tacgtctgccaaggaaacccggtgggggattggaccaagatcaacggctgttcggatcct
tcctatgtggtggactgggtgaccggcgagatcttcaacttccacgtcttgtcctatcag
gcaggtattcaggaagcacacgtgggcaacgatcatgaggaccggttcgtgatccaggtg
gaagtctcgcgttcgaaggacgatggtaaatcctgggagagcgaaacaattaccaagaca
gtcacgcctgatccaaaagtacggtggcggttcgcagcttctggacaaggcatccagatc
cgcaacggaaaacacgctggacgcctcgtacaacagttcacgcaggccaaggaaggttcg
actgctcaagaagccttctccctctactccgatgaccatggcgcaacctggcatgcagga
caacccgtgggcactgagatggacgagaacaaagtcgtcgaaagggctgacggttcgctg
ctgcttaactctcgcgagcgcaccggggccaatcgttcgcgctggcaagcggaatctttc
gacggcggcgctacctggtctaagccgtggcttgcgaccgacattgtcgacgcgatgacg
aatggccagccgattcgggcgtttccgcaagcgactccagaagacccacgctcgagtatt
ctgctgtttgccaacgcgcagatcttccagtcttacaaccgtaagaaggggacaatctgg
atgtcatgcgatgggggtagcacctggccgatctccaaagttttcaatgaaggatcaacc
gggtatgccacgatcacggtgcaaaacgacggtcgaatcgggatgctcaccgaggacgga
ctcggggatagtaaggaaagcggcatcttctaccgaagctttggtcttggatggttggag
caatcctgtgcaagcatgacggcttcggacgttgagggctcagcggccggcgaatcagtc
actatcccagcaaaaatcgcctccacgacgggaacggtggcgggtgaattgaccgctgtc
gggttgcccgccggatggaccgcagacccggtgcacgtgagtggggaggacggagaaatc
cagctgaatattcccgagtccgcgatcgaagggacctatcacatctcattgcgttacgtc
ggagatgacggtgcggtagccgccaaggcagtgcaggtgtccgtagttgacgacacacga
gtaccgcgcgatcacctggtggcagtgtgggccaattcgaacgacgggaacccaatcgga
ttggcgtttgatgacaatccagccaccttctggcattcacaatggcaaaacaagcctgct
gagctcaacaacaatcacgatattgtggtgtcgctggccgacgaacatgacctgacgaag
atcggctacctgccaccacagcgcgatcagaagaacggggcgttcaagaactacgaagtc
tttgtgggacaacgtggcgccaatgcttcatgcgctgacattggcggttgggcatccgtc
gctagcggagaattggcgtatgagcggagatacttctcgggtatttctctcgaccaggaa
gctgcacgccaagtcgactgcctcaagattcacgtctctggagaacatactggtcctagc
ggtacgaacgcctctgcggcggagattaggctctacggcacaaagaacgcaattgtttcg
ccgacgccaacggtaagcaccacgacggttactgcaactactacggagacgacgacgcag
caggagaccgtgatttcgacgatatatgagaccgaaacgcaggagccggtgactatcacc
gagccaacgacggtgaccgagccaacgacggtcaccgtgacgacgacggtcgccgagccc
tccagggttaccgagccaacgacggtcactcagccaacaaccgttacagcaacgcatacc
gagcccaccactgttaccatgacaatcacggtgcctactacgtctacggaacgctctacg
gtcacggaatcgacgaccataacggtccctactacggtaaatgcgacggtggctgaaccg
acggtcctcactacaacaacgacagtgcctaccaccgtcacggcagcgacaaccgtgacc
acgacggtgactgtcctcccgcaggtaactacctccacgacaagcccggcacctacactc
gaactcgaccacaatcaaagtggatacaagtggggcagagtcatcgcctggctcgtggcg
atagggggcgggctgttggcaatggtgccaccgctgcttaactatctacgaacccaggga
ttcatctag

DBGET integrated database retrieval system