KEGG   Cellvibrio sp. PSBB006: CBR65_03465Help
Entry
CBR65_03465       CDS       T04891                                 

Definition
(GenBank) hypothetical protein
Organism
cell  Cellvibrio sp. PSBB006
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(819037..830661)
Genome map
AA seq 3874 aa AA seqDB search
MNLVDVLKSRAESCSDKVAFFNLIDANKTTGVTYRELEIRARSIAALLQSLGLKRQRVLL
MFPSGIEFIAAFWGCIFAEVTPVPVFTPKKRKEHWSRLDQIAIDCEALAILTSKNNEELI
RGVQQDPGFAISSIKCIVTDQIGSDFASSWIQPNINQSTVAFLQYTSGSTGNPKGVIVTH
KNLIHNQKMMAEAFSQTEKSIFVTWLPLYHDMGLIGNVLLNVYLGAECNIMTPASFLAQP
YLWLKAISNHKGTSSFAPNFAYELCANRITDEQKSTLDLSAWKFALNGAEPIRADTLKRF
VKAFSPCGFSSNGCYPGYGLAEATLFVTGGDKLAPPITKTVDSDELKKGVVAPAISVKSQ
SELVCSGKAWDGQLIKIVNPETYEEAKPNEVGEIWLQGDSVAQGYWNKEEETKLTFHAFI
KNTHEGPFLRTGDQGFVDADNQLYITGRLKELIIIRGRNYYPQDIEYTVQEHPELKESSG
AAFSINVDQHGEKLVVVQEVERTFLNSANYDDLFIKTREAISENHDIQLHAIVFIKPATL
PKTSSGKIQRRKVRDSFINNQLVEVARMVWAPMELEEVSFPDDHYWSSVAKENLDDEIFY
QFKKFIGKLLGVAESEINDGFTLGRYGMDSVSAVRLHYELGIPLESVLGDAVISEIGQVL
KNEILLKLAGENNNNSNCSASEFNPNSLSYNQQSIHHLDQLSKGTGAYHIALPLQVKELD
VEVFRKTLNSLLKKHESLRSFFSYKDGVLSQGVNNTFAVPYFTHDASESTIEQLEKEIKS
SINQEIDLCTGSVFRVEHFKISNEKAILLFVFHHIAVDLFSIKILLDDLGSIYTAFLVGK
DADSIKKPEKYKDYVQEQWLYLHSDRMERDWLHWKENLSGELPILSLPTLQPRGVRQSFN
GGFLDIDISPETTKNLKDLSLRSGATLNVILLAVYQLVLSRFSNQKDICIGLPAAGRLRK
KWEDVVGYFVNPVVVRYRLDHNHTFREHLECVKKTVLNTLKHQEYPFPLLVERLCKSHNP
AISPIYQTMFALYPKRDIGELGAFIFSDKDARMHLGALEVESFPIDPSFSQMDISLFLIE
KDDGMKGRIQFNKDLLSKSLVNSFAEHFVNSLNDCVKNEEVSLVDVKSYSIDEYDKIRKM
WKPDRTEYSSRKFVHQLINDQLSGNAASTALIVDFERLSYAELLDRTSRLTNFLQKHEIG
PECVVGICMDRSIDMVVSILAILNAGAAYLPIDPDYPDARIEYILTDANPEVVLSHSTCN
PKLGMTRQKVLYVDQLSHEIGNCENTFIERKLHADNIAYIIYTSGSTGRPKGAANTHGAI
LNRLQWMQKEFGLDTSDCVLQKTSFGFDVSVWEFLWPLMYGATLAMAKPGGHRDSHYLCN
YINEVGVTTIHFVPSMLELFLDEATHVRPSYLKRVICSGEELKASLQKKFFNVFHNVLLS
NLYGPTEAAIDVSSWQCNAKDQNTIIPIGKAISNISLYVLDENLNPLPIDVPGQLYIGGV
GLARGYVANPALTAQRFIPDPFSSEPGSRMYATGDLACFQVDGNLNYLGRADFQIKLRGF
RIELGEIEASLEQHENIIQVVAKVHHEKESAILAVYCLAKDHAGFYPEELTRFLRKSLPE
YMIPSFFIQVNAFPINANGKLDRKQLELPKDEINPNNAYREPTTTNEILIAGVWREALKV
ERVGLTDSFFSLGGHSLNANKVIFQIKSLLSVDITVAALFESPVLIDFVRAVENKRANIT
HLPVDLARNIVANKLTHAQESIYFLTSLDGASAVYNIPSVHKIVGPLDIDVLARCIKDLM
IQHESLRTTFIPSDEGLVAKVTENVDSNLIYIDLRGLPDTELEPRITQLIDEEVHTPFDL
EKGPLFRSVLLQKGNSEFIFIINMHHIISDGWSLGLILRDLSSLYNGSSSDSAKNIAPVS
YLAFSSWQRTLSDKNHYEYQLDYWKNQLRDQPPILNLPTNKRRPSKRSYRGSTINIGLPK
DIVKRLNEWSLKENSTLFMTLLAAFKVIMMRFSSEKDISVGIPVSNRTLPEVEEVVGLFV
NTLVIRSRVDDELTFGEFLKEVKQTTLNAYSNQDVPFEVVVKHVSQGRNLSYTPLFQVMF
NFQKEMQSKLDFELLRAEALPLNQKLAKFDLTFSLEEKHEEIKGYIEFNSDVYSRETIQE
LFSHYCNLLNTILVSGHAKIRTIDLLSPSEREKILVDWNNTKREYPDTACLHELFLTQAL
SNPNSIAILYKDQSITYKELNEQSDRVAGWLISYGIRPDDLVAICMDRSPELIIGLLGIL
KAGAGYLPIDASYPQDRISFILQDAGVGLLIADTKSQNLLRSTGCTVINFNALGKHSNFS
TSIILPKSNSRQLAYVNYTSGTTGTPKGTEIEHRSVVRLLFGVDYINLDAKSRVLHASSI
SFDASTFEIWAALLHGGCCVLLADRLPTGDSFQRMIEDYRVNVMWITAPLFNSIIDEEAE
KLCGVEQLIVGGDALSVPHIQQALKVLHGTRLINGYGPTESTTFTCCYPIPEVISEPEAI
SIPIGKPIGNTSVYILDNNLNPAAIGIPGELYIGGDGLARGYLNRPGLTANVFIPNPFSP
EEGGRMYRTGDMARFLPDGKVEYVGRVDNQLKIRGFRIEPQEVVIALKNIECVNEAIVVP
DIAKTGEKRLLAYVVVKENSGVSASSIETSLASVLPEYMMPESIMLLDKFPLSSTGKVDR
NQLPKPLKVEQHLQGSIVPAATLTEEQLVSVWKDLLDIEHLSVTDNFFEIGGHSLILIRI
VARIKKQFSVNISIESIFENPTIRKLAALIDLRDKDSGTIGNQFYKIETRPYYPQSFAQK
RFWFLDSLEGGSSNYNVQGCWSYKGALDHDLVTEAVEVMVKKHEILRTSFKSIDNEPVQI
VHSEARVDVVLHDLSQNSSDENSEIVRLLIKDHADKCFDLSRCPIFNIQMIRLATHETLL
LINIHHIITDGWSVELFIKEFCAVYQLLLNGNPPQILNSGFQYVDYTYWQNKWLESGAAQ
SQVAYWRRELASAIPLIELPTDRPRNSVQSFKGGVITFSFSDELSKKLVSLSKRYECTLF
HLTLAAFNVLLSKYTGQSDISVGTPIANRDLVEVDGMLGLFLNTVVLRNKIPQGMTFLSF
LESVKQNALNSFSNKDVPFEQIVEEINPERSLSHSPLFQVMFTLLNHRNTNSINGVELDN
IRIDRWISKFDLSLFIDNSEKGLEGSFEFSRDLFDESTIRRMVNNYVTLLSNIADDPLTA
IEHLSILSSDEYETIVVEWNAHPSVVEAGVCIQDLIRLQTNRSPNNTAVIFRDQSLTYSE
LHSRVNQLAYYLVSENVGPETRVGVCLNRSASMLVAMLAVLQAGGTYVPIDPNYPRERIQ
LILGDSSPKVLLTERSVVEKHFANSMLKETQLFLLDENVHLLEKYPSTLCKHAASPENLA
YVIYTSGSTGRPKGVAITHANAVAMLSWGLEKYTVDELEGTLASTSICFDLSVFEIFLPL
ICGGTVLLVENALELLTMPNRELVTLVNTVPSAIDAILKVQNLPASVKVVNLAGEPLSRK
LVDKIYEQKEVEKVYNLYGPSEDTTYSTWSLVSKKVPEKPLIGKPISNTQCYVLDKSLQP
VPVGVSGELYIGGAGVSRGYLGRPDLTAERYIPSPFGPPGDRLYKTGDVVRYLPNAELDY
IGRNDHQVKLRGFRIELGEIENCIASMPGVEEAVLKLHNAKNGEQLLIAYITGNDQVKLE
SSQLKIAVTSSLPPHMVPSRFIFLKQMPLTSNGKIDRKGLPEPDDMDESSAYVAPKTKTE
KALADIWKSLLKKEISLNGDFFALGGHSLLVVQLSVKINESFGLNISMKDIFQHPDLEGL
SDFIDFSLWISESNNKDINVLSNYEDQAFETGEL
NT seq 11625 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagtcgatgtattgaagagtcgtgcagaatcctgtagcgataaagtcgcgttc
tttaatttaatagatgcaaataagactactggtgtcacatatcgtgagttggaaattaga
gctaggtcgattgcggccttattgcaatcgctgggtttaaaacggcagcgagttctgctt
atgttcccctcgggtattgagtttattgcagcgttttggggatgtatttttgcggaagta
acccctgttcctgtcttcacgccaaaaaaaagaaaagagcattggtcaaggctagatcaa
atagcaattgattgcgaagcattggccatactgacctctaaaaataatgaagagctaata
agaggcgttcaacaagatcctggtttcgcaatcagttcgataaagtgcattgtgacagac
cagattggtagtgatttcgcatcttcctggatacaacccaatatcaatcaaagcactgtc
gcttttcttcaatatacctctggttcaacaggcaaccctaaaggggttatcgttactcat
aagaatttaatacataatcaaaaaatgatggcagaggctttttcccaaacggaaaaaagt
atctttgtcacttggttgcctctgtatcatgatatgggactcattggaaacgttctgttg
aacgtttatctgggggcagagtgcaacataatgactcctgcatctttcttggcccagccg
tacctatggttaaaagcaatcagtaatcataaaggcacgtcaagttttgctcctaatttt
gcctacgagttatgtgccaatagaatcaccgatgagcaaaaatcgacgctcgacctgagt
gcatggaaatttgctctaaatggagctgaacctattcgggcagatacattaaaacgattt
gttaaggcgttttcgccctgcggttttagttcaaatggctgttatcccggatatggactt
gccgaagcaactttatttgtaacggggggagacaagctcgcgccaccaatcacaaaaact
gttgattccgatgagctaaagaaaggcgttgtcgcccccgcaataagtgtaaaaagtcaa
tccgagttggtttgctctggtaaggcgtgggacgggcaattaattaaaattgttaatcct
gagacctatgaggaagctaaaccaaatgaggttggtgaaatatggcttcagggtgacagt
gtcgctcagggatattggaataaagaggaagaaacaaagcttacttttcatgctttcata
aaaaatactcatgaagggcctttcctaaggacaggcgaccaggggtttgttgatgctgat
aatcagttatacattaccggtcgtttgaaagagcttattattattcgtggaagaaactat
tatccccaggatattgaatatacagtacaggaacatccggagttaaaagaaagcagcggt
gctgcgttttccattaatgtcgatcaacatggtgaaaagctggtagttgttcaggaagtg
gagcggacctttttgaacagcgcaaattatgatgacctattcataaaaactcgcgaagcc
atatctgaaaaccatgatattcaattgcatgcgattgtttttataaagccggccacatta
cccaaaacatcaagtggtaaaattcaaagacgaaaagtccgtgattcatttataaataac
caacttgttgaagtggcgcgaatggtgtgggcgccaatggagttggaagaagtttctttt
cctgatgatcactattggagttctgttgcaaaagaaaatcttgatgatgaaatattctac
caatttaaaaaatttattggaaaattattgggtgtagctgagtcggaaatcaatgatggc
ttcactctgggtcgatatggtatggactctgtctccgccgtcaggctccattatgaatta
gggattcctttagagtctgtgttgggagatgcagtcatatcggaaatcggacaagtttta
aaaaatgaaattttattaaaattggctggcgaaaataataataattctaattgtagtgct
agtgaatttaatccaaactcattgtcctacaaccagcaatccatacatcatctggatcag
ttatcaaaagggacgggggcttatcacattgcgttgcctctgcaagttaaggaacttgat
gttgaggttttcagaaaaactttaaattcactattgaagaaacatgagtctttgcgttct
tttttctcttataaagatggtgttctatcccaaggtgtaaataatacgtttgcggttcct
tattttactcacgatgcctctgaatctactattgagcagctcgaaaaagagattaaaagt
agcattaaccaagaaattgatctctgtacgggatctgtattcagggtggaacatttcaag
ataagtaacgaaaaagctatcttattgtttgtatttcatcatattgctgtcgacctcttt
tccataaaaattttattagatgacctggggagcatatatacagcctttctggttggtaaa
gatgctgactcgataaaaaaacctgaaaaatataaagattatgtgcaggagcaatggctt
tacctgcacagcgacagaatggaaagggattggcttcattggaaggagaacctttccggt
gagcttccaatattaagtttgcctacgcttcagcccagaggtgtcaggcagtcctttaat
ggtggctttcttgatatagatatatcacccgaaacaacaaaaaatttaaaagatttaagt
ttacgttctggcgctactctgaatgtaatattgctcgcagtgtatcagctggtgctatcc
cgtttctctaaccagaaagatatttgtatagggctacctgctgcgggaagattaaggaaa
aaatgggaagatgtggttgggtattttgtaaatccggtggtggttcgctacagattggac
cataaccatacttttcgtgagcatctggaatgcgtcaaaaaaacggtattgaacacgctt
aaacatcaggaatatccttttcccttgttggttgagcgcctttgtaaatcgcacaacccg
gctatatcgcccatctatcaaactatgtttgcactatatcctaaaagggatattggagag
ttgggggcatttatttttagtgataaagatgcgcgaatgcaccttggtgcgctggaggtt
gaaagttttcctatagatccgtccttttcacaaatggatatatcgctgtttcttatcgaa
aaagatgatgggatgaaaggcagaattcagtttaacaaggaccttctttccaaatcattg
gtgaacagttttgcggaacattttgtgaattcgctcaatgattgtgttaaaaatgaagag
gtttctcttgtcgatgttaaatcatattctattgatgaatatgacaaaattcgaaaaatg
tggaagcctgaccgcactgaatattcctctaggaaatttgttcatcaactgattaatgat
caactatcagggaatgcagcaagtaccgccttgatcgttgatttcgaaagattaagctac
gctgaattactcgatagaacctcaaggcttaccaatttcctacaaaaacatgaaattggt
ccggaatgcgttgtaggtatttgcatggatcgatctattgatatggtcgtttcaattcta
gccatcctgaatgcaggtgctgcgtaccttccaatagatccagattacccggatgcaagg
atcgaatacatcttaaccgacgctaatcccgaagtggttctaagtcattccacatgcaat
ccgaaattgggaatgacaaggcaaaaagttctatatgtagatcaattaagtcatgaaatt
ggtaattgcgaaaacacatttattgagcggaagttacatgcagataatatagcctacatc
atatatacatctggctctacaggtcgacccaaaggagcggccaatacccacggcgccatc
ttaaaccgcttgcagtggatgcaaaaagagtttggactggataccagtgattgcgtgttg
caaaaaaccagtttcggctttgatgtctctgtgtgggaatttttatggcccttgatgtac
ggtgcgaccttggctatggccaaaccgggcgggcaccgggatagtcactatctgtgtaat
tacatcaatgaagttggcgtgacgacgatccattttgttccctcaatgttggagctcttt
ttagatgaagcaacccacgttagaccctcgtatttaaaaagagtgatttgtagcggtgag
gagctaaaagcttcgcttcaaaagaaattttttaatgtttttcataatgtcctgctaagc
aatttatacgggccaacggaagcagctattgatgtcagctcctggcaatgtaatgctaaa
gatcagaacaccataattcctattggaaaggccatttctaacatttccctttatgtgttg
gatgagaacctaaatccattacctatagatgtgcccggtcagctttatattggtggcgta
gggcttgcgaggggctatgtagctaatcccgcacttactgcgcaacgatttattcctgat
ccttttagctccgaacccgggtcaagaatgtatgctactggcgacttggcctgttttcag
gtagatggaaatcttaattatttgggaagggctgatttccaaataaagcttcgcgggttc
aggatagaactgggagaaattgaagcctcgctcgagcaacatgaaaatattattcaggtc
gtggcaaaagtccaccatgaaaaagaatccgctatattggctgtttattgtttagctaag
gaccatgccgggttttatcctgaagagttaacgaggttcctaagaaagtctttacctgaa
tacatgattccttcattttttatccaggtaaatgcatttcccataaatgcgaacggtaag
cttgatcgaaaacaattggagctgccaaaggatgaaatcaacccgaacaacgcataccgg
gaaccaactacgactaatgagatcctcattgccggggtatggcgtgaggcccttaaagta
gagcgagtggggttaacagacagctttttttcattaggcgggcactcgcttaatgcaaac
aaagtaatttttcaaattaagtcattgttgtctgtagatatcacagttgctgcactattt
gaaagtccggtacttattgactttgtccgcgcggtcgaaaataagagggcgaatataacg
caccttcctgttgatctggcgagaaatatagtggccaacaagctaacccatgcccaggaa
agtatctattttctaacttctctggatggtgcttctgctgtctacaacattccttcggtt
cataaaatagttgggcctctggatattgatgtattggctcgctgtataaaagatttaatg
attcaacatgagtccctgagaactacctttattccttccgatgaaggacttgttgcaaaa
gttactgaaaacgttgattcaaatttaatttatattgatctgcgaggattgcctgatact
gaactagagccccggataacccaactaattgatgaagaggttcacactccttttgatttg
gaaaaaggtccgctgttcagaagtgttttgttgcaaaagggtaatagtgaattcattttt
attataaatatgcatcatattatttctgatggttggtcattaggtcttattttgcgtgat
ctatcctcactgtataacggatcatcaagcgattcggcgaaaaatatagctcccgtcagc
tacttggctttctccagttggcagcggaccttaagcgataagaatcactatgagtaccag
ttggattattggaaaaaccagctcagagaccagccgccgatattgaatctgccgacaaat
aaaagaagaccaagcaagagaagttatcgcggtagcacaatcaatattggattaccaaag
gatatcgtcaagcggctaaatgagtggagccttaaggaaaatagtacgttattcatgacg
ttgctggcggccttcaaagtcatcatgatgcggttttcatctgaaaaagatatatctgta
ggtattcctgtttcaaatagaacgctcccggaagttgaagaggtcgtaggcttatttgta
aatacattggtaattcgatccagggtcgacgatgagttgacgtttggcgaatttttaaaa
gaagtcaagcaaacgacattaaatgcctattccaatcaggatgttccgtttgaagtagtt
gtgaagcacgttagccaggggcgtaacctgagttacacaccgctttttcaggtaatgttt
aactttcaaaaggaaatgcaaagtaagcttgatttcgagcttttgagagccgaggcttta
cccctcaaccaaaaattagcaaagtttgatttaactttttcccttgaggaaaagcatgag
gaaataaaaggttatattgaatttaacagtgacgtgtacagtcgagagactattcaggaa
ttgttttctcactattgtaatcttttgaatacaattttggtttccggtcacgctaaaatt
agaacaatcgatctattaagcccatcagagcgagaaaaaattcttgtcgattggaataat
acaaaaagagaatatcccgatactgcttgccttcatgagctttttctaacacaggcatta
tcaaatccaaattcaatcgccatcctatacaaagaccaatctataacctacaaggagctc
aatgagcagtctgacagggtggctggttggctgattagttatggcatccgcccggatgat
ttggtggccatatgtatggatcgctcaccggaattgataattggattgctcggaatcctc
aaggctggtgcaggctacttgccgattgatgcatcctatccccaggatcgcatcagtttt
atattgcaagacgcaggggttggtttattaattgccgatacgaaatctcaaaatctattg
agaagtacaggttgtacggtaattaatttcaatgcccttggtaaacattcaaacttttcg
acttcgattattctacctaagtcaaattctcgacagttggcctatgtcaactatacatcg
ggcaccacgggaacccccaaaggtaccgaaatcgagcaccgatcagttgtgcggttgtta
tttggcgtggattatataaatctcgatgcaaaaagtcgtgtcctccatgcttcttccatc
tcatttgatgcttctacatttgaaatatgggcagctttgcttcatggcggttgttgtgtg
ctattggcggaccggctccccacaggcgatagttttcaaagaatgattgaggattatcgg
gtcaacgtcatgtggattactgctcctttgttcaatagtattattgatgaagaagcagaa
aaactttgcggtgttgaacaactgattgttggtggcgatgcgctttccgttcctcacata
caacaagctctgaaagtattgcatggaacgcgattgattaacggttatggacctaccgaa
agtaccacgtttacctgttgttatcccatacctgaggtaatcagcgagccagaggcaatt
tcaattcctattggcaagccaattggaaacacaagcgtctatattctggataacaatctg
aaccctgcggcaataggtattcccggcgagttgtacatagggggagacggccttgcgaga
gggtaccttaaccgccccggattaactgcgaatgtgtttatcccaaatcccttttctccg
gaagagggtgggcgcatgtaccgtaccggggatatggcacgattcctccccgatgggaag
gttgaatatgttggtcgggtagacaaccaactcaaaattcgcggcttccgcatagagccc
caggaagtggttattgcgcttaagaatattgagtgtgttaatgaagcaattgtagtaccg
gatattgctaaaaccggtgaaaagcgtttacttgcctacgtggttgtaaaggaaaactca
ggtgtgagtgcctcttcaatagagacctcccttgcttcggttcttcccgaatacatgatg
cccgagagcattatgttattagataaatttccattgtcgtcaaccggtaaggtagatagg
aaccagctgcccaagcctctaaaagtcgaacagcatcttcagggttctatagtgccggct
gcaacgctgacggaagaacagcttgtaagtgtttggaaagacttactggacatcgaacat
ttaagcgtaacggataatttctttgaaataggcggccattcgcttatcttgataagaatt
gttgccagaattaaaaagcaattttcggtaaatatttcaatagaatcgatttttgaaaat
cccacgatcagaaaattggcagccctgatcgatcttcgagataaagattccggaactata
ggcaaccagttttataaaattgaaactcgcccctattatccgcaatcgttcgcccaaaaa
aggttttggttcctggattcattggagggtggtagctctaattataatgttcagggatgc
tggtcttataaaggtgctttggatcatgaccttgtcaccgaagctgtcgaggtcatggtc
aaaaaacacgaaatactaagaacctcctttaaaagtattgacaatgaaccggtgcagatt
gtccattcagaggcgagggttgatgtcgtattgcatgacctatcccaaaatagctcagat
gaaaattcggaaatagtacggcttcttattaaagatcatgcagataaatgtttcgatctt
tccaggtgcccgatattcaacattcaaatgatacggttggccacccatgaaactctatta
ttaataaatattcatcacatcatcacagatggatggtcggttgagctatttattaaggaa
ttttgtgccgtatatcaattgttactgaacggaaatccgccgcaaatcctaaactccgga
ttccaatatgttgattatacttattggcaaaataaatggttagaaagcggcgctgcgcaa
tcacaagtggcctattggcggcgagaactggcaagcgccatacccctgatcgagttacct
accgaccgtccaagaaatagtgttcagagctttaaagggggagttattacgttctccttt
tcagatgaattatcaaaaaaactggttagcttaagtaaaaggtacgaatgcacactattc
catttaaccctggctgcatttaacgttttattgtcaaaatataccggccaatcagacatc
tctgtgggaacgcccattgccaacagggacctggtggaagttgatggtatgttaggttta
ttccttaatacggtagtgttaaggaataaaattccccaaggtatgacctttttgtctttc
cttgaaagcgtcaaacaaaatgccttgaactcattttccaataaagatgtcccatttgag
caaattgtggaggagattaatcccgagcgaagcctaagtcactcaccgttgtttcaggtg
atgttcactttgctcaaccataggaatacaaactcgatcaacggcgttgaattagataat
atcaggatagatcgttggatttcgaaattcgatctgagtctgtttattgataactctgaa
aaaggcctggaagggagctttgagttcagcagagatttatttgatgaatccacgatccgg
agaatggttaataattatgtcacactgttatctaacattgccgatgatccattaaccgct
attgaacatctgtcgatactatcgagcgatgaatatgaaacgatagttgtagaatggaat
gcacacccatctgtggtggaagccggagtctgtatccaggatttgatccggcttcagaca
aataggtcaccaaataatacagcggtaatttttagagaccagtcattaacatacagtgaa
ttgcacagtagggtaaatcagctcgcttattaccttgtatctgaaaatgtaggcccggaa
acccgtgttggagtctgcctcaaccgctcagcttcaatgttagtagctatgttagctgtt
cttcaggctggcggtacttatgtcccgatcgacccaaattatccccgcgaaaggattcaa
ttaatcctgggtgattcatcccccaaagttttattaacggaacgatccgttgttgaaaag
catttcgcgaattcgatgttgaaggaaacacagttatttttgctggatgagaatgtacat
ctccttgaaaaatacccttctacactctgcaaacatgccgcctcaccagaaaatctggcg
tatgttatctatacatccggatcaacggggcggccaaaaggcgttgcaattactcatgca
aatgcggtggcgatgctttcctggggtcttgaaaaatacacagtggatgaactggaaggt
accttggcatccacatctatttgctttgatctatctgtctttgaaatattcctgccactt
atttgtggtggaacagtattgcttgtggaaaatgcccttgaactgctaacaatgcccaat
cgcgaattggtcacgttagtgaatacagtcccatccgcaattgatgctattttaaaggtc
cagaatctgcctgcctctgtgaaagttgtaaatttagcgggtgagccgctatccagaaaa
ttagtggataaaatatacgaacaaaaagaggttgaaaaagtttacaacctttatgggcct
tctgaagacaccacttactccacatggtcgttggtttccaaaaaagttccggaaaagcca
ctaatcgggaagccgatttccaatacccagtgttatgttctggacaaatcccttcaacca
gttcctgtcggtgtatcaggcgagctttacataggaggtgccggtgtaagtcggggatat
ctggggcgtcctgatttaactgcggagcggtatattccatcaccctttggtccgccgggc
gatcgcctctataaaacgggtgacgttgttcgatatcttcccaatgccgaacttgactat
attggacgaaatgaccatcaggttaagttaagggggtttcgtattgaattaggcgaaata
gaaaactgtattgcaagtatgcccggggtggaggaggcagtattaaagctgcataacgct
aaaaatggcgagcaattgttaattgcttatataacgggtaatgaccaggtaaaactggaa
tcttcccagttgaaaatcgccgttacttcatccttgccgccgcatatggttccctcccgg
tttatttttctgaagcagatgccattaacctccaacggaaaaatagacagaaaaggactg
ccagaacctgatgatatggatgaaagcagcgcttatgttgcgccgaaaacaaaaactgaa
aaagcattggccgatatttggaaatcgctgctgaagaaagagattagtttgaatggcgac
ttctttgcgttgggcggccattcactgctcgttgttcagttgtcggtaaaaataaatgaa
tcatttggtttaaatatctccatgaaagatatctttcaacacccggatcttgagggcctt
tctgactttatagattttagtttgtggatctcggagtcaaataataaagatattaacgtt
ttgtcaaattacgaagatcaagcctttgagactggggaattatga

DBGET integrated database retrieval system