KEGG   Crinalium epipsammum: Cri9333_0948Help
Entry
Cri9333_0948      CDS       T02373                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cep  Crinalium epipsammum
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cri9333_0948
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cri9333_0948
   00680 Methane metabolism
    Cri9333_0948
Enzymes [BR:cep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cri9333_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1063139..1066273)
Genome map
AA seq 1044 aa AA seqDB search
MSSLLHTHDQELTVTSASDLFLRHRLKVVEDLWESVLRQECGQELVDLLKQLRSLCSPEG
QTPELPETSVPKLIEKLDLNSAIRASRAFALYFQLINIVEQHYEQREQQLSLRANHHLPA
TNKAVLPPTSATISPAPNIGDLEELQPNSPNNNLGADLLEKTLQDNGVPPRDQGTFHWLF
PYLRSMNVPPQHIQRLLNNLEIRLVFTAHPTEIVRHTIRGKQRRIAHLLQQLDQAEEGMN
SLGLNYSLEAETFEEQLTEEIRLWWRTDELHQFKPTVIDEVDYTLHYFEQVLFEAIPQLS
RRLKQALKDSFPWLTPPNHKFCQFGSWVGSDRDGNPSVTPEVTWQTACYQRGVVLEKYIQ
SLRQLTDLLSLSLHWSDVLPELLESLEQDRGRMPEVYDRLAIRYRQEPYRLKLAYILARL
ENSRDRNSQLAYGDHQKWQNSDTYAKSFYRTGEEFLAELQLIQHNLKETGLSCRDLENLI
CQVEIYGFNLAYLDIRQESSRHSDTINEIVEYLQVLHKPYNELTETERSLWLATELQTKR
PLIPSELPFSQKTSETVESFRMLRQLHQEFGSPICQTYVISMSHDVSDLLEVLLLAKEAG
LYDPRTGITSLQVVPLFETVEDLKRAPAVMEALFELPFYRALLAGGYEVAQANSEQTQPQ
IINSQSQTPIKSSSAITPHLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALQKIAEKYNLN
LRIFHGRGGSVGRGGGPAYEAILAQPGHTIKGRIKITEQGEVLASKYSLPELALYNLETV
TTAVIKASLLGTSFDDIQPWNEIMEELSVRSRAHYRSLIYEQTDLVDFFHQVTPIEEISQ
LQISSRPARRGGKKDLASLRAIPWVFSWTQSRFLLPSWYGVGTALQEFLNEEPDENLNLL
RYFYFKWPFFKMAISRVEMTLAKVDLQMAHHYVRELSKPEDIERFEALFDQIAKEYNLVC
ELVLTITGHKRLLDGDPELQRSVQLRNGSIVPLGFLQVSLLKRLREHGKLTTTGVVHSRY
SKGELLRGALLTINGIAAGMRNTG
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgctactccatacgcacgatcaggaattgacggtaacatctgcctctgatcta
tttctgcgccatcgtctcaaggttgtagaggacttatgggagtctgttctgcgacaggag
tgcggtcaggaactggtcgatttgctcaagcaattgcgctctctttgttcaccagagggg
cagactcctgaattgccagaaacctcagtaccaaagctgattgaaaaacttgacctcaat
tcagcaattagggcttcccgcgcttttgccctatatttccaactgattaatattgttgaa
cagcactacgagcaacgggaacaacagctttcactgcgggctaatcaccatcttccggcg
acaaataaggctgtattaccaccaacatcagccacaatttcccctgcgcctaatattggc
gacttagaggagttgcagcctaattctcccaacaataatttgggagcagacttgctggaa
aaaactttgcaagacaatggtgtaccacctagagatcaaggtactttccattggctattc
ccctacttgcgctctatgaatgtgccaccgcaacacatccagcgcctactgaacaatcta
gagattagattagtatttaccgctcacccgacagaaattgttcgccataccatcaggggc
aaacagcgacgaattgctcatcttctgcaacaactagatcaagcagaagaaggcatgaac
agcttaggtttaaattattccttggaagctgaaacctttgaagaacaactaactgaagaa
attagattgtggtggcgcactgatgagttgcatcaatttaagccaacggtgatcgatgag
gtagattacactcttcactattttgagcaagttttatttgaggcaattcctcaactctct
cgccgcttaaaacaagctttaaaggattcttttccctggttgactcctccaaatcataaa
ttctgccagttcggttcttgggtaggttcagaccgtgatggtaatccatcggtaacacca
gaagttacttggcaaactgcttgttaccaacggggtgtggtgctggaaaaatatatccaa
tctttacggcaacttacggatcttttaagcttatcgttgcactggagcgatgttttacca
gagttactagaatctttggaacaggatcgcggacggatgccagaagtatacgatcgccta
gcaattcgctacaggcaagaaccttacaggctgaagttggcttatatcttggcacggtta
gaaaatagtcgcgatcgcaattcgcaacttgcctatggcgatcatcaaaaatggcaaaac
tcagacacctacgctaaaagtttttaccgcactggtgaagagtttttagcagagttgcaa
ttaattcagcacaacctgaaagaaacaggcttaagttgccgtgatttagaaaacttgatt
tgtcaggtggaaatttacggatttaatctggcatatctggatattcgtcaagaaagttct
cgccattcggatactatcaacgaaattgttgaatatctccaagttttacataagccttat
aacgagcttacagaaacggagcgatcgctttggttggcaacagaactgcaaactaaacgc
ccattaattccatctgaactgccattttcccaaaagacttctgaaacagttgaaagcttc
cgaatgctgcggcagttacatcaagagtttggctctccaatctgccaaacttacgtgatc
agcatgagccatgatgttagcgaccttttagaggtgttgctactagctaaggaagctggt
ttatatgaccccaggacaggtatcactagcttgcaggtagtaccgttatttgaaacggtt
gaagatttgaaacgcgccccagcagtgatggaagcgctgtttgaattgcctttctatcgg
gcattacttgctggaggttatgaagttgctcaagctaatagcgaacaaacacaaccccaa
attattaattctcaatcccaaacaccaataaaatcttcatcagctatcacacctcactta
caagaagtgatgcttggttattctgatagcaataaagattctggtttcttaagcagtaat
tgggaaattcacaaagctcaaaaagctttgcagaaaattgcagaaaagtataatcttaat
ttacgcatttttcacgggcgcggtggttccgtaggtcgtggtggtggacctgcttatgaa
gcgattttggctcaaccaggtcatacaattaaaggcaggattaagattacagaacaggga
gaagtattagcttctaaatactctctaccagaattagctttgtataatctcgaaacagtt
acaacggctgtgattaaagcgagtttgctcggaaccagctttgatgatattcagccttgg
aacgaaattatggaagaattgtcagtgcgatcgcgggctcattatcgctccctaatttat
gaacaaacagatttagtagacttcttccaccaagtcacaccaattgaagaaattagccaa
ctgcaaattagttctcgtcccgcccgtcgtggtggtaagaaagatttagccagtttgcgg
gctatcccttgggtatttagctggacgcaaagccgtttcctactaccttcttggtatggt
gttggtacagccttgcaggagtttttaaacgaagaaccagacgaaaacctcaacctgctg
cgctacttttacttcaaatggccgttctttaaaatggcaatctctagagtagagatgact
ttagcaaaagttgatctacagatggctcaccattacgtgcgtgaactatctaaacctgaa
gatattgaacgttttgaagctttgtttgatcagattgccaaagaatacaatttggtttgc
gaacttgtgctgactattactggtcataagcggcttttagacggagacccagaattgcag
cgttctgtacagttacgaaatggtagcattgtacctctgggtttcttacaagtttctttg
ttgaaacgtctgcgagaacacggcaagcttacgacaactggtgttgtacactcccgatat
agtaagggtgaattgctacgtggagccttattaactatcaacgggattgctgctggtatg
cgaaatacaggctga

DBGET integrated database retrieval system