KEGG   Crinalium epipsammum: Cri9333_2695Help
Entry
Cri9333_2695      CDS       T02373                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cep  Crinalium epipsammum
Pathway
cep00010  Glycolysis / Gluconeogenesis
cep00520  Amino sugar and nucleotide sugar metabolism
cep01100  Metabolic pathways
cep01110  Biosynthesis of secondary metabolites
cep01120  Microbial metabolism in diverse environments
cep01130  Biosynthesis of antibiotics
cep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cri9333_2695
   00520 Amino sugar and nucleotide sugar metabolism
    Cri9333_2695
Enzymes [BR:cep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cri9333_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFZ13551
UniProt: K9W019
LinkDB All DBs
Position
complement(3025295..3026002)
Genome map
AA seq 235 aa AA seqDB search
MVVENKSILTLAVDIGGSGIKVIVLDEAGKPQTERSRVETPQPPKPDVVINAIASLAATQ
GVFNRVSVGFPGVVRGGITETAANLDSDWLGFDLGAALSDRLGKPVRVINDADMQGFGAI
SGIGVELVVTLGTGFGSALFLNGKLIPNLEIGHHPFRKSETYEEQLGREALEKVGDKKWN
NRLEKAIASLQRMLNYDYLYIGGGEAKKVSIYLPPNVKIIPNISGLLGGIALWRD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagagaataaatctatccttacattagccgtcgatattggcggcagtggcatc
aaagttatcgtgttagacgaagctggcaaaccccaaactgaacgtagccgcgtggagaca
ccacaacctcctaagccagatgtggtaattaatgcgatcgcttctttagcagccacacaa
ggggtatttaaccgcgtatctgtcggctttcctggggtcgtgcgtggcggtattactgaa
acagcagcaaacttagattctgattggttagggtttgatttaggcgcagcactatctgat
cgtttaggtaagcctgtacgagtaatcaatgatgctgatatgcagggttttggggcgatt
tcaggtattggagttgaactggtagttaccttgggaactggttttggttcagcactattt
ttaaacggcaaattaatcccaaatttggaaataggacaccacccatttcgcaaaagtgaa
acctacgaagagcaactagggcgagaagctttagaaaaagttggcgataaaaaatggaat
aatcgcttagaaaaagcgatcgcttccctacaacgtatgcttaactacgattacctttat
atcggtggtggtgaagccaaaaaagtcagcatctacctaccaccaaatgtcaaaatcatt
cccaatatttcaggtttattaggtggtatcgccttgtggcgagattag

DBGET integrated database retrieval system