KEGG   Canis familiaris (dog): 403630Help
Entry
403630            CDS       T01007                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     403630 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
8
AA seq 815 aa AA seqDB search
MDGPRSDVGRWGGNPWQPPTTPSPEPEPEPEPERRSRRGGRSFWARCCGCCSCRNRADDD
WGPEPHRDRGSGSGRRRPDSRGSDSRRPGSRASGVNAAGDGTIREGMLVVTGVDLLSSRS
DQNRREHHTDEFEYDELIIRRGQPFHMVLHFSRPYESSDRVALELLIGNNPEVGKGTHVI
IPVGKGGSGGWKAQVTKASGQNLNLRVHTSPNAIIGKFQFTVRTHSEAGEFQLPFDPHNE
IYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACL
YILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEIL
LSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMK
PLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKN
GLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAVGSNMQDDVTH
IYKHPEGSEAERKAVETAAAHGSKPNVYTNRDSAEDVALQVEAQDAVMGQDLTVSVVLTN
RGSSTRTVKLHLYLSVTFYTGVTGPVFKESKKEVVLAPGATERVSMPVAYKEYRPQIVDQ
GSMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLT
NVVFRLEGSGLQRPKILNVGDIGGNETVTLHQKFVPVRPGPRQLIASLDSPQLSQVHGVI
QVDVAPAPGGGGFFSNAGGNSPLGETIPMASRGGA
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggatggtcctcgttcagatgtgggccgctggggcgggaacccctggcagccccctacc
acaccttcgccagagccagagccagagccagagccagagagacggtctcgtcgaggaggc
cgttccttctgggctcgctgctgtggctgctgctcctgccgaaacagggcagatgatgac
tggggacctgagccccaccgagaccgagggtctggctctgggaggcgaagacccgactcc
cggggctcagattcccgccggcctggctcccgggccagcggtgtgaacgcagctggagat
ggcaccatccgagagggcatgctggtggtgactggtgtggatctgctgagttcgcggtca
gaccagaatcgccgagagcaccacacagatgagtttgaatacgatgagttgattatacgc
cgtgggcagccttttcacatggttctgcacttctctcgcccctatgaatcctctgatcgc
gtcgccctggagctgcttattggaaacaaccctgaggtgggaaagggcacccacgtgatc
atcccagtgggcaaggggggcagtggaggctggaaagcccaggtgaccaaggccagtggg
cagaatctgaacctccgagtccacacctcccccaatgccatcatcggcaagtttcagttc
actgtccgcacacactcagaggctggcgagttccagctgccttttgacccccacaacgag
atctacatcctctttaatccttggtgcccagaggacatcgtgtacgtggaccatgaggac
tggcgacaggagtacgtgcttaatgagtctgggagaatctactacgggactgaagcacag
attggtgagcggacctggaactatgggcagtttgatcatggggtgctggatgcttgcctg
tacattctggaccggcggggcatgccatatggaggccgtggggaccctgtcagtgtctcc
cgggtcatctctgccatggtgaactccttggatgacaatggggtcctgattggaaactgg
tctggtgattactctcgaggcaccaacccttcagcgtgggtgggcagcgtggagatccta
ctcagctacctccgcactggctattctgtcccctatggccagtgctgggtcttcgccggt
gtgaccaccacagtgctgcgttgcctgggcctggctacccgcactgtcaccaacttcaac
tcggcacatgacacagacacatccctcaccatggacatctactttgacgagaacatgaag
cccctggagcacctgaaccatgattctgtttggaacttccacgtgtggaatgactgctgg
atgaagaggccagacctgccctctggctttgacgggtggcaagtggtagacgccacgccc
caggagaccagcagcgggatcttctgctgtggcccctgctctgtggaatccatcaagaat
ggcctagtctacatgaagtatgacacacccttcatttttgccgaggtcaacagtgacaaa
gtttactggcagcgacaggacgatggcagcttcaagatcgtgtatgtggaagagaaggcc
attggcacgctcattgtcacaaaagctgttggatccaacatgcaggacgatgtcacccac
atctataaacacccagaaggctcagaagcagagcgcaaggcggtggagacagcagctgcg
catggcagcaaacccaacgtgtacaccaaccgcgactcggctgaggatgtggccctgcag
gtggaggcccaagacgcagtgatggggcaggacctgacagtctccgtagtgctgaccaat
cgcggcagcagcacccgcactgtgaagctgcatctctacctctcagtcaccttctacact
ggtgttacagggcctgtcttcaaggagagcaagaaggaagtggtgctcgcgccaggggcc
acggaacgcgtgtccatgcctgtggcctacaaggaataccggccccaaatcgtagaccag
gggtccatgctgctcaatgtctcaggccacgtcaaggagaatggacaggtgctggccaaa
cagcataccttccgtctgcgcaccccagatctctccctcacattattgggggcagctgtg
gttggccaggagtgcgaagtacagattgtcttcaagaaccccttgcctgtcaccctcacc
aatgtcgtcttccggcttgagggctccgggctacagagacccaagatcctcaatgtgggg
gacattgggggcaacgagacagtgacactacaccagaagtttgtgcctgtgcggccaggc
ccccgccagctcatcgccagcttggacagcccacagctctcccaggtgcatggtgtcatc
caggtggacgtggctccagcccctgggggtgggggcttcttttcaaatgctggaggcaat
agtcccttgggggagaccatccctatggcatctcgaggtggggcttag

DBGET integrated database retrieval system