KEGG   Canis familiaris (dog): 485867Help
Entry
485867            CDS       T01007                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
cfa  Canis familiaris (dog)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    485867 (TGM2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     485867 (TGM2)
Cell adhesion molecules and their ligands [BR:cfa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     485867 (TGM2)
   VLA-5
     485867 (TGM2)
   VLA-9
     485867 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
24
AA seq 687 aa AA seqDB search
MAEDLVLEKCDLELEANGRDHHTAGLCQGRLVVRRGQPFWLTLHFTGRSYESSVDSLTFS
AVTGPDPSEEAGTKARFSLSSAVEEGAWTAVVMDQQDSVLSLQLSTPPNAPVGLYRLSLE
ASTGYQGSSFVLGHFTLLFNSWCPADAVYLDSDEERREYVLSQQGFIYQGSVKFIKSIPW
NFGQFEDGILDICLMLLDRNPKFLKDACRDCSSRSNPIYVGRVVSAMVNCNDDQGVLLGR
WDNNYKDGISPMFWIGSVDILRRWKTSGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
FNSAHDQNSNLLIEYVYNKFGEIQKEKSEMIWNYHCWVESWMSRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAAFVFAEVNADVVNWIQQDDGSLCKSTNNSQ
TVGMKISTKSVGRDEREDITHNYKYPEGSPEEREAFRKANHLNKLTEKEETGLAMRIRVS
ESMSMGSDFDVFAYINNNTSESHSCRLLLHARTVSYNGILGPECGTKDLLNLSLEPFSEK
SIPLRILYEKYCECLTESNLIKVRGLLVEQAANNYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEASLRNPLTVPLLGCSFTMEGAGLTEEQKVMDVPDPVEAGEEVKVRVDLLPRHVG
RHKLVVNFESDKLKAVKGFRNVLIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggttctcgagaaatgtgacctggagctggaagccaatggccgtgac
caccacacggctggcctgtgccaggggaggctggtggtgcggcggggccagcccttctgg
ctgaccctgcacttcaccggccgcagctatgagtccagtgtggacagcctcaccttcagc
gccgtgacgggcccagaccccagcgaggaggccgggaccaaggcccgcttctccctgtcc
agtgctgtggaggagggtgcctggacggccgtggtgatggaccagcaggacagcgtcctc
tcgctgcagctcagcaccccgcctaacgccccggtcggcctgtaccgcctcagcctggag
gcctccaccggctaccagggctccagcttcgtgctgggccacttcactctgctcttcaac
agctggtgcccagcggatgctgtgtacctggactcagatgaggagcggcgggagtacgtg
ctcagccagcagggcttcatctaccagggttcagtcaagttcatcaaaagcatcccttgg
aactttgggcagtttgaagatggaatcctggacatctgcttgatgctcctggacaggaac
cccaagttcctgaaggatgcctgccgtgactgctccagccgcagcaatcctatctatgtg
ggccgggtggtgagcgccatggtcaactgcaatgatgaccagggtgtgctgctgggacgc
tgggacaacaattataaggacggcattagccccatgttctggatcggcagcgtggacatc
ctgcggcgctggaagacctctggctgccagcgtgtcaagtatggccagtgctgggtcttc
gctgctgtggcctgcacagtgctgcggtgcctcggcatccccacccgagtggtgaccaac
tttaactcggcgcatgaccagaacagcaacctgctcatcgagtatgtctacaacaagttt
ggggagatccagaaggagaaaagcgagatgatctggaactaccactgctgggtggagtca
tggatgagcaggccggacctgcagcctggctatgaggggtggcaggccctggaccccacg
ccccaggagaagagcgaagggacatactgctgtggcccggtcccggtgcgtgccatcaag
gagggtgatctgagtaccaagtacgacgcggcttttgtcttcgccgaggtcaacgccgac
gtggtgaactggatccagcaggacgatgggtccttgtgcaagtccaccaacaactcccag
accgtggggatgaagatcagcactaagagcgtgggccgtgatgagcgggaggacatcacc
cacaactacaagtacccggaggggtccccagaggagagagaagccttcagaaaggccaac
cacctgaacaagctgactgaaaaagaggagaccgggttggccatgcggatccgcgtgagc
gagagcatgagcatgggcagtgactttgacgtctttgcctacatcaacaacaacacgtcc
gagagccactcctgccgcctcctgctccatgcccgcaccgtcagctacaacgggatcctg
gggcccgagtgtggcaccaaggacctgctcaatctttccctggagcccttttccgagaag
agcatcccccttcgaatcctctatgagaagtactgtgagtgtctgacagagtcgaacctc
atcaaggtgcggggcctcctcgtggaacaagccgccaacaactacctgctggccgagagg
gacatctatctggagaatccagaaatcaagatccggatcctgggagagcccaagcagaac
cgcaagctggtggctgaggcgtccctgcggaaccccctcaccgtgcccctgttaggctgc
agcttcaccatggaaggggccggcctcactgaggagcagaaggtcatggacgtcccggac
cccgtggaggcgggggaggaggtcaaggtgagagtggacctgctgccacgccacgtgggc
cgccataagctggtggtgaactttgagagcgacaagctaaaggctgtgaaaggcttcagg
aatgtcctcattggtcccgcctaa

DBGET integrated database retrieval system