KEGG   Citrobacter farmeri: CI104_00800Help
Entry
CI104_00800       CDS       T05012                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cfar  Citrobacter farmeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CI104_00800
Enzymes [BR:cfar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CI104_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(160512..162542)
Genome map
AA seq 676 aa AA seqDB search
MKLAAIALALLPGIASAATWTSQGFPSFTAEGTGKFASHAELMKGTRSLTLNFDHQCWQP
ANAIKLNQMLSLIPCEGTPPQWRLFKDGSYTLEIDTRSGTPTLMITVPREAEPTANVVRQ
CPTWDGSPLTLEVAQTFPEGSVVRDFYSGQTAMVKNGQITLQPAPASNGLLLLERAETDA
PAPFDWHNATVYFVLTDRFENGDPSNDQSYGRHKDGMEEIGTFHGGDLRGLTRKLDYLQQ
LGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALIDGA
HQRGIRILFDVVMNHTGYATLADMQEYQFGALYLSGDELKKTLGDRWTDWKPTVGQSWHS
FNDYINFSDKAAWEKWWGKAWIRTDIGDYDNPGFDDLTMSLAFLPDLKTGSTIPSGLPVF
YQHKADTRAKAIEGYTPRDYLTHWLSQWVRDYGVDGFRVDTAKHVELSAWQQLKTQASAA
LVEWKKNNPDKALDDEPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAADCLSG
MDLTWQQMAEKLQGFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSDMNWQDISGKSADNVAHWQRLGQFRARHPAIGAGQQTTLSLKQGYGFV
RQHGDDIVMVIWAGQR
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgctattgccctcgcgctgctgccaggtatcgcgagcgccgcaacatgg
acgtctcagggcttcccctccttcaccgccgagggaaccggtaagtttgccagccacgct
gagttgatgaagggtactcgctcattaacactaaattttgaccatcagtgctggcagccg
gcaaacgcgataaaactcaatcagatgctctcgctgatcccatgcgaaggcaccccgccg
cagtggcgtctgttcaaagacggcagctacacgttggaaatcgatacccgttctggcacg
ccaacattgatgattacggtgccgcgcgaggccgaaccaacggcaaatgtggtgcgccag
tgtccaacgtgggatggttcgccactgacgttagaggtcgcgcaaactttcccggaaggc
agcgtggtacgcgatttttacagcggacagaccgctatggttaaaaacggacagataacc
ttacaacccgctcccgccagtaacggcctgttactgctggaacgggcagaaaccgatgca
cctgctccgttcgactggcacaacgctaccgtctattttgtgctgaccgaccgcttcgag
aacggcgatccctctaatgaccagagttacggtcgccataaggatggcatggaagaaatc
ggtacgtttcacggtggcgatttacgcggtctgacccgcaaactggattatctgcaacaa
ctgggcgtgaatgcgttatggataagcgcgccgttcgaacaaatccacggctgggtgggc
ggtggcacgaaaggcgatttcccacactatgcctatcacggttattacacccaggactgg
accactcttgatgccaacatgggcagcgaggccgatcttcgtgcattgattgatggcgca
catcagcgcgggatccgcattctctttgatgtggtgatgaaccataccggctacgccacg
ctggcagatatgcaggaatatcaattcggcgcgctctatctttctggcgatgagttgaaa
aaaacgctcggcgatcgctggacagactggaaacccaccgtcgggcaaagctggcacagc
ttcaatgattacatcaactttagtgataaggccgcctgggaaaaatggtgggggaaagcg
tggatccgcactgacattggcgattacgacaacccaggctttgacgatctcacgatgtcg
ctggcttttctgccggatctgaaaaccgggtcgacgatcccctccggcctgccggtgttt
tatcaacataaagccgatacgcgcgcgaaagccattgagggctacacgccccgggattac
ctgacccactggctgagccaatgggtgcgcgattatggtgtcgatggatttcgcgtcgac
acggcgaaacacgtcgaactttcggcctggcaacagttaaaaacgcaggccagcgcagcg
ctggtggaatggaaaaaaaacaacccggacaaagcgctcgatgatgagccgttctggatg
accggcgaagcctggggccacggcgtgatgcagagcgattactatcgtcatggttttgac
gcaatgatcaactttgactatcaggaacaggccgcaaaagcggccgattgcctgtctggt
atggatctcacctggcaacagatggcggaaaaactacagggctttaatgtgttgagctat
ctctcttcgcacgatactcgcctgttccgcgaaggtggtgataaagcggctgaattgctg
ctgttagcccccggtgctgttcagatattctatggggatgaatcctcacggcctttcggc
cctaccggttccgatccgctacagggcacgcgctcagatatgaactggcaggatatcagc
ggtaaatcagccgacaatgtcgcccactggcaacgcctcggtcagttcagagcccgacat
ccggccatcggcgcgggtcagcaaaccacgctctcgctcaaacaggggtacggtttcgtg
cgtcagcatggcgacgacatcgtgatggtcatttgggcgggtcagcgctaa

DBGET integrated database retrieval system