KEGG   Chlamydia felis Fe/C-56: CF0661Help
Entry
CF0661            CDS       T00332                                 

Gene name
sodM
Definition
(GenBank) Mn superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfe  Chlamydia felis Fe/C-56
Brite
Enzymes [BR:cfe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CF0661 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: BAE81433
UniProt: Q253V5
LinkDB All DBs
Position
complement(765019..765636)
Genome map
AA seq 205 aa AA seqDB search
MTLVPYTLPELPYDYDALEPVISAEIMHLHHQKHHQAYVNNLNDALKKAEVAGVQQDLTR
LISLEPSIRFNGGGHINHSLFWEMLAPIDRGGGVPPKHELLKLIEKFWGTFDNFLKEFIE
FAAPIQGSGWAWLAFCPKKQMLMLQATVNQDPLEATTGKVPLLGVDVWEHAYYLQYKNVR
LDYLKAIPRVINWGYIEKRFSEITK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgtaccctatactttacccgaattgccctacgattacgacgctctagaacct
gtgattagtgccgagattatgcacctacatcaccaaaagcatcatcaagcttatgtaaat
aatttgaatgatgctttaaagaaagcagaggtcgccggtgtgcagcaagaccttacgcgt
cttatttccctagagccctccatacgttttaatggcgggggacacatcaatcactctctt
ttttgggaaatgcttgcccccatagatcgcggtggtggagttcccccaaaacacgaatta
ctcaagcttattgaaaaattctgggggacttttgacaattttttaaaggaatttattgaa
tttgcagcgccaattcaagggtcgggatgggcttggctagctttttgtcccaaaaaacag
atgcttatgttacaagcaacggtaaaccaggatcccctagaggcgaccactggaaaggtg
cctcttctcggagtggatgtttgggagcatgcttactatctccagtataaaaacgttaga
ttagattatttaaaagcaattcctcgagtgattaattggggatatattgaaaaaagattt
tctgaaataactaaataa

DBGET integrated database retrieval system