KEGG   Cellulomonas fimi: Celf_2762Help
Entry
Celf_2762         CDS       T01490                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cfi  Cellulomonas fimi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celf_2762
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Celf_2762
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Celf_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3071082..3072887
Genome map
AA seq 601 aa AA seqDB search
MTLPPMPDVRPREPAPTTGQIMLTALPQKRQPTVPAPGEARPGLSDDPDWYRTAVFYEVM
LRCFSDASGQGSGDLRGLIDRLDYLQWLGIDCLWLPPFYPSPLRDGGYDVADYTAIAAQY
GTVADFQELISEAHARGMRLVIDLVMNHTSDQHPWFQASRSDPEGPYGDFYVWSDDNTRY
QDARIIFVDTETSNWTFDPVRRQYFWHRFFSHQPDLNFENPRVVEAMMDVARFWLRIGVD
GFRLDAVPYLFEAEGTNCENLPETHAFLRDVRRMIDEEFPGRIMLAEANQWPEDVVHYFG
TEQEPECHMCFHFPVMPRIYYSLRDQRATPIIDILADTPPIPKGAQWSTFLRNHDELTLE
MVSTEERASMYGWYAPDSRMRANVGIRRRLAPLLDNSRKEIELAHALLLSLPGSPCLYYG
DEIGMGDNIWLPDRDAVRTPMQWTPDRNAGFSTADPGKLYLPLVQSLVHHYSHTNVEAQL
AQPTSLLHWVRGMLTVRRRYPALGKGEFVVVPSDNESVLTFLRVTPEQTLLVVANMAATA
RSATVSLPSYAGWSMHDVFGGAPFPAVRAEGSALFTLGSRDFYWLELEPPAGEPDGARGA
R
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgcccccgatgccggacgtccgaccgcgggagcccgcaccgaccaccggccag
atcatgctgaccgcgctgccgcagaagcggcagcccaccgtgcccgcgccgggcgaggcc
cgcccggggctgagcgacgatccggactggtaccgcaccgcggtgttctacgaggtcatg
ctgcgctgcttctccgacgcgtcggggcagggcagcggcgacctgcgcggcctcatcgac
cgcctcgactacctgcagtggctcggcatcgactgcctgtggctgccgccgttctacccc
tcgccgctgcgcgacggcggctacgacgtggcggactacacggcgatcgcggcgcagtac
ggcacggtcgcggacttccaggagctcatctccgaggcccacgcgcgcggcatgcggctc
gtcatcgacctcgtgatgaaccacacgagcgaccagcacccgtggttccaggcgtcgcgc
tccgacccggagggcccgtacggcgacttctacgtgtggagcgacgacaacacgcgctac
caggacgcgcggatcatcttcgtcgacaccgagacgtcgaactggaccttcgaccccgtc
cgccggcagtacttctggcaccggttcttcagccaccagccggacctcaacttcgagaac
ccgcgcgtggtcgaggcgatgatggacgtcgcccggttctggctgcggatcggcgtcgac
ggcttccgcctggacgcggtgccctacctgttcgaggccgagggcacgaactgcgagaac
ctcccggagacgcacgccttcctgcgtgacgtgcggcgcatgatcgacgaggagttcccc
ggccggatcatgctggccgaggcgaaccagtggcccgaggacgtcgtgcactacttcggc
accgagcaggagcccgagtgccacatgtgcttccacttccccgtcatgccgcgcatctac
tactcgctgcgcgaccagcgggcgacgccgatcatcgacatcctcgcggacacgccgccc
atcccgaagggtgcgcagtggtcgacgttcctgcgcaaccacgacgagctcacgctcgag
atggtgtccaccgaggagcgcgcgtcgatgtacggctggtacgcgccggactcgcgcatg
cgcgccaacgtcggcatccgccgccggctcgcaccgctgctcgacaactcccgcaaggag
atcgagctcgcgcacgccctgctgctgtccctgccgggcagcccgtgcctgtactacggc
gacgagatcgggatgggcgacaacatctggctgcccgaccgtgacgcggtgcgcacgccg
atgcagtggaccccggaccgcaacgcgggattctcgacagccgaccccggcaagctctac
ctgccgctcgtgcagtcgctcgtgcaccactacagccacacgaacgtcgaggcgcagctc
gcgcagccgacgtcgctgctgcactgggtccgcgggatgctgacggtccgccgccgctac
cccgcgctcggcaagggggagttcgtcgtcgtcccgtcggacaacgagtcggtcctgacg
ttcctgcgcgtgacgcccgagcagaccctgctcgtcgtcgcgaacatggcggcgacggcg
cggtcggcgacggtctcgctgccgtcgtacgcgggctggtcgatgcacgacgtgttcggc
ggcgcgccgttcccggcggtgcgcgccgagggctcggcgctgttcacgctcggctcgcgg
gacttctactggctcgagctggaacccccggccggcgagccggacggtgcacggggggcg
cgatga

DBGET integrated database retrieval system