KEGG   Colletotrichum fioriniae: CFIO01_02926Help
Entry
CFIO01_02926      CDS       T04796                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CFIO01_02926
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFIO01_02926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: EXF75339
UniProt: A0A010RC79
LinkDB All DBs
AA seq 154 aa AA seqDB search
MVKAVAVVRGDSKVTGSVVFEQESESAPTTITWDITGNDANAKRGMHIHTFGDNTNGCTS
AGPHFNPHNKTHGAPEDANRHVGDLGNIETDGQGNSKGTVTDKHVKLIGPESVIGRTVVV
HGGTDDLGKGDNEESLKTGNAGPRPACGVIGISN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgtcgtccgtggtgactccaaggtcaccggctccgttgtcttc
gagcaggagtccgagtccgctcccaccaccatcacctgggacatcaccggtaacgatgcc
aacgccaagcgtggcatgcacatccacacctttggtgacaacaccaacggctgcacctct
gccggccctcacttcaacccccacaacaagactcacggcgcccccgaggacgcgaaccgc
cacgttggtgaccttggcaacatcgagaccgatggccagggtaactccaagggcaccgtc
accgataagcacgtcaagctgatcggccccgagagcgtcatcggccgcaccgtcgttgtc
cacggcggcaccgacgacctcggcaagggtgacaacgaggagtccctcaagactggcaac
gccggtccccgtcccgcctgcggtgtcattggtatctccaactaa

DBGET integrated database retrieval system