KEGG   Colletotrichum fioriniae: CFIO01_05025Help
Entry
CFIO01_05025      CDS       T04796                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cfj  Colletotrichum fioriniae
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CFIO01_05025
Enzymes [BR:cfj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CFIO01_05025
Transporters [BR:cfj02000]
 Other Transporters
  Pores ion channels [TC:1]
   CFIO01_05025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 280 aa AA seqDB search
MANVDTSIGARTTGAAADFAAKHSEEHPLKLYGGWFCPFVQRSWIVLHEKQIPHQYIEIN
PYKKDPEFLKMNPRGLVPTLAVPVDVKGNEQRPLYDSTVVSEYLEEAYAGNNYGPHLLPE
ATYDRARCRLWIDHINSRVVPAFYKFIQHTPEKEYSIEKARDEFLGHIKTFTVQMDPEGP
WFLGKTFSLVDVMIAPWAMRLFLFDHYKPGGLGIPSEGESGDDEAVWKRWRQWYYAIKER
QSVKDTLSDEDAYIEVYKRYAEDKTNSGVGQATRGGGKLP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtggacacatcaatcggcgcgcgtaccacgggtgccgcagccgacttcgca
gcaaagcactcggaagagcacccattgaagctctatggcggctggttctgcccttttgtc
cagcgatcatggattgtactccacgaaaaacagattccccaccagtacatcgagatcaac
ccgtacaagaaggatcccgagttcctcaagatgaaccctcgggggctggtcccgacgctg
gccgtccccgtggacgtgaagggcaatgagcaacgaccgctctacgacagcactgtggtt
tccgagtacctcgaggaagcgtacgccgggaacaactacgggccacatcttcttcccgag
gcgacgtatgatcgcgcgaggtgcaggctgtggatcgatcacatcaactctcgcgttgtg
ccggccttttacaaatttattcaacacactccagagaaggagtacagcatcgaaaaagca
cgtgatgagttcttgggtcacatcaagactttcactgtacagatggaccccgaaggtccc
tggtttttgggcaagacgttcagtctcgtggacgtgatgattgccccttgggccatgcgc
ctgttcctattcgatcattacaagccaggaggacttggcattccctctgaaggggagagt
ggcgatgatgaggcggtatggaagaggtggaggcaatggtactatgctatcaaagagagg
caaagcgtaaaggatacgcttagtgacgaggatgcctatattgaggtgtacaaacggtac
gccgaggataagaccaactcaggggtgggacaggcaacaagaggcggaggaaaactgcct
tga

DBGET integrated database retrieval system