KEGG   Colletotrichum fioriniae: CFIO01_07112Help
Entry
CFIO01_07112      CDS       T04796                                 

Definition
(RefSeq) iron/manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfj  Colletotrichum fioriniae
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CFIO01_07112
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFIO01_07112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 232 aa AA seqDB search
MSSTLLRTAPVLRTALRAGAAKPAAAALASTSFVRGKATLPDISYDYGALEPYISAQIME
LHHSKHHQTYVNGLNTALETVEDANAKGDYAKAAAQAPLINFHGGGHVNHSLFWENLAPA
SRDGGGEPDGKLAQAIKEDFGSFDTLRKQINTSLAGIQGSGWAWLVKDKTSGTLGVVTRA
NQDPVTGNLEPLLGIDAWEHAYYLQYQNRKAEYFDAIWNVVNWKTVAKRFEK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaccctcctccgtaccgcgcccgtcctccgcacagctttgcgagctggtgcc
gctaagcctgctgctgctgctttggccagcaccagcttcgttcgcggcaaggctactctg
ccagacatctcttacgactacggtgcccttgagccctacatctcggcacagatcatggag
cttcaccactccaagcaccaccagacctacgtcaacggcctcaacaccgctctcgagacc
gtcgaggatgccaacgccaagggcgactatgccaaggctgctgctcaagctcccttgatc
aacttccacggcggtggccacgtcaaccactctctcttctgggagaacctcgcccctgcc
agcagagatggcggtggtgagcccgacggcaaattggctcaagccatcaaggaggacttt
ggctccttcgacaccctgcgcaagcagatcaacacctccctggccggaatccagggcagc
ggttgggcctggctggtcaaggacaagaccagcggcacccttggcgtcgtcactcgcgcg
aaccaggaccctgtcaccggcaacctcgagcctcttcttggtatcgatgcttgggagcac
gcctactacctgcagtaccagaaccgcaaggccgaatactttgacgccatctggaacgtt
gtcaactggaagactgtggccaaacgcttcgagaaataa

DBGET integrated database retrieval system