KEGG   Colletotrichum fioriniae: CFIO01_08347Help
Entry
CFIO01_08347      CDS       T04796                                 

Definition
(RefSeq) linoleate diol synthase
Organism
cfj  Colletotrichum fioriniae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 1077 aa AA seqDB search
VLGYTPGVQATIAHAEWRRDLPLRTCSAYHGPESEGPTGRRCVKSLAIDVKFDQILTARE
DLKTLVQIIKSKIKREKIQDDKTMIMERTIQIVAKLPHNSRLREQLTNTFIEELWGSLDH
PPMLYMGDEYKYRQADGSYNNPMLPRLGAAGGPYARSVKPRIVTLGAMPDPGLIFDAVMG
RTSYKKHPNNVSSILWYWATIIIHDLFWTDFKDMTKSKTSAYLDLSPLYGSNQEMQNSIR
TFKDGKLKADSFADKRLIGMPPGVCVLLIMFNRFHNHVAENLAAINEGGRFTPPSKDLNE
EKTAAALKKYDEDLFQTARLVTSGLYINITLVDYVRNIVNLNRTNTTWTLDPRQEAGIDA
GTPDGAEAGTGNVNSAEFNLCYRWHSCISDKDDKWIQKFYGKLLGNKGQMSPQEMACVFG
QFEKSIPDDPGMRTFAEYERDEDGKFDDDDLVDCISSAIEDCAGAFGARNVPQVMRPVEI
MGILQGRKWNVAGLNEFRKHFGLKPHERFEDINSDPAVADQLRNLYQHPDYVELYPGLVA
EEAKTPLTPGVGIAPTYTISRVVLSDAVCLVRGDRYYTTDYNPRHLTQWGYKEVEYDLNV
NHGCVFYKLFLRAFPNHFKGNSVYAHYPMVIPPENHQILTDLGRVNQFDFERPKPIPTRT
NITSFGGVKYVLDSQSRFKVTWDEGLSFLMGKGGSRFMLSGDTDFHTGQKKCMSAQLYQD
DWSSHVKKFYAEITEQLLREKSYKLAGQTHVDIIRDVGNIAHVHFAARVFNLPLKTHKNP
KGVFTEQEMYQILAVIFVCIFFDIDPAKSFPLRQAAKEAAQSLGKLIETNVKITTKTGLR
GIFTGSADKQDPLALYGTNMIKGLDKAGLSTYNIAWSQILPTSGAMVPNQAQVFAQAVDY
YLSPPGSKHLDQIHAVAKAPSTKESDAVLLGYAMEGIRLAGTFGSYREAVQDDVIVEDGG
REVPVRRGDKIFVSFVSAAKDANHFPHPEEVNPRRPIDSYIHYGLGPHSCLGRDASQVAL
TEMFRALFRRTNVRRVPGPQGLLKKVPRPGGFFVYLKEDWGQIWPFPVTMKVMWDDE
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
gttctcggatatacgccgggcgtccaagcgaccattgcccatgcagaatggcgacgggac
ctacccctcagaacttgctcggcctaccatggtccagaatctgaaggccctacaggccgc
aggtgtgtgaagagtcttgccatcgacgtaaagtttgaccagatactgacggcgagagaa
gatctcaagacactcgttcagatcatcaaatccaagatcaagagggagaagattcaagat
gacaagactatgattatggaacggacgattcagattgttgccaagctcccacacaactct
cgcctacgagagcaactgacaaacactttcattgaggagctctgggggtcacttgaccat
cctccgatgctttacatgggcgacgaatacaaataccgtcaggctgatggatcttacaat
aatccaatgctccccaggctaggagctgccggaggaccatatgccagatctgtcaagcct
cgtatcgtcaccctgggcgctatgccggacccgggcttgatcttcgatgccgtgatgggg
cgcacgagctacaagaaacaccccaacaacgtttcgagtattctttggtattgggcaacc
attattattcatgacctcttctggacggacttcaaagacatgacgaagtccaaaacgtct
gcgtatcttgatctctcgccattgtatggaagcaaccaggagatgcaaaattcaatcaga
accttcaaagatggcaagctcaaggccgatagtttcgctgacaagcgtctgatcggaatg
ccacccggagtctgtgtccttttgatcatgttcaaccgattccataaccatgtggcggag
aatttggctgctatcaacgagggaggaagattcacaccgccaagcaaagatctcaacgag
gagaagacagctgcggctctgaagaagtacgacgaagacttgttccagactgcgagactt
gtgacatctggcctctatatcaacatcacattggtcgactacgtacgaaacattgtcaat
ctcaaccgtaccaacacgacttggacactcgacccccgacaggaggctggcatcgatgcc
ggcacacccgatggggcggaggcaggtactggaaacgtcaactccgctgagttcaacctt
tgctaccgatggcattcgtgtatctcagacaaggatgacaagtggatccagaagttctac
ggcaagctcctaggcaacaagggccagatgtcccctcaggaaatggcctgcgtttttggg
cagttcgagaagtctatcccagatgaccctggcatgcgtacttttgcggagtacgaaagg
gacgaggatggaaagttcgacgatgacgaccttgtagactgcatcagctctgcgattgaa
gattgtgctggagcgtttggagctcgaaacgtcccccaggttatgcggcctgtcgagatc
atgggcatcttgcaaggacgcaagtggaatgtcgctggtctgaacgaattccgcaagcac
tttggcctcaaaccccatgaacgttttgaagacatcaactcggaccccgctgtcgcggat
caactaaggaacctctaccaacacccagactacgttgaactgtaccctggcctcgtggct
gaggaggcaaagacacccctgacacctggtgttggcattgcccccacatacaccatctct
cgtgtcgttctctcggacgctgtctgtctggttcgcggcgacaggtactacaccacggat
tacaacccccgacacctgactcaatggggttacaaggaggtcgaatatgacttgaacgtc
aaccatgggtgtgttttctataagctgttcctcagagctttccccaaccatttcaagggc
aattctgtttatgcccattatcccatggtcattccgccggaaaaccaccaaattctcacg
gacctgggaagagtcaatcagtttgattttgagcgccccaaacccattccaacaagaacc
aacatcacatcctttggcggtgtcaagtacgtcttggatagccaaagtcggttcaaggtg
acgtgggacgaggggctgtccttcttgatgggcaagggcggaagccgcttcatgctttcc
ggagacactgacttccacacgggccagaagaagtgcatgagtgctcaactctaccaagac
gactggagttctcatgtcaagaaattttatgccgagattacggaacaactacttcgcgag
aagtcatacaagcttgctggtcaaacacacgttgacatcattcgagacgtaggcaacatc
gctcacgttcatttcgccgccagagtgttcaatctccctctgaagacacacaagaatccc
aaaggcgtcttcactgaacaggagatgtatcagatcttggcagtcatctttgtctgcatc
ttctttgacatcgacccagccaagtcttttcctcttcgtcaagccgcgaaggaggcagcg
cagtcgctgggcaagcttatcgagacgaatgtcaagatcactacgaagactggacttcgt
gggatcttcactggctcagcagacaagcaagaccctctcgcattgtacggaaccaacatg
atcaagggtctcgataaggccggtctgagcacttacaatatcgcttggagccagattctg
cctacatcgggagcgatggtgccaaatcaagctcaagttttcgctcaagcggttgattac
tatctctcacctccagggtcgaaacacctcgatcaaatccatgccgttgcaaaggcaccc
tctactaaggagtctgatgctgtgttgcttggctacgccatggagggcattcgacttgct
ggcacgttcggttcttaccgtgaggcggtccaagacgatgtcattgtggaggatggtggt
cgagaagtgcctgtgagaaggggagataagatatttgtcagttttgtatccgccgcaaag
gatgcgaaccacttccctcatccagaggaggttaacccgcggaggccgatcgattcatat
atccattacggccttggcccgcactcttgcctgggccgcgacgcaagccaggttgctctt
acagagatgttcagagcgctcttccggaggacaaatgtcaggcgcgtgccggggccccag
ggactattaaagaaagtgccaaggcctggcggtttctttgtgtacttgaaagaggattgg
ggtcagatttggccgttcccagttaccatgaaggtgatgtgggacgatgaatga

DBGET integrated database retrieval system