KEGG   Cellulomonas flavigena: Cfla_2079Help
Entry
Cfla_2079         CDS       T01230                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfl  Cellulomonas flavigena
Brite
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cfla_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADG74974
UniProt: D5UFV1
LinkDB All DBs
Position
2322326..2322955
Genome map
AA seq 209 aa AA seqDB search
MADYTLPDLPYDYAALEPHISGRIMELHHDKHHAAYVAGANTALEKLAAAREADDFATVN
LQEKNLAFNLGGHVNHSVFWENLSPDGGDKPVGELAAAIDEFFGSFDAFKKHFAANAVGI
QGSGWSILGWDSVGRKLAIFQLYDQQSNYPLGLVPIVVLDMWEHAFYLDYVNVKADYVKA
WWNIVNWADAAERFARARTQTAGLIVPTS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgactacacgctcccggatctgccgtacgactacgcggcgctcgagccgcacatc
tccggcaggatcatggagctgcaccacgacaagcaccacgccgcgtacgtggcgggcgcc
aacacggcgctggagaagctcgccgcggcacgcgaggccgacgacttcgccacggtgaac
ctgcaggagaagaacctggcgttcaacctcggcgggcacgtcaaccactcggtgttctgg
gagaacctctcccccgacggcggcgacaagcccgtcggcgagctggcggccgcgatcgac
gagttcttcggctcgttcgacgcgttcaagaagcacttcgccgccaacgcggtcggcatc
cagggttcgggctggtcgatcctcgggtgggactccgtcggccggaagctggcgatcttc
cagctgtacgaccagcagagcaactacccgctgggcctggtcccgatcgtcgtgctcgac
atgtgggagcacgcgttctacctcgactacgtcaacgtgaaggcggactacgtcaaggcc
tggtggaacatcgtcaactgggccgacgccgcggagcgcttcgcgcgtgcccgcacgcag
acggcgggcctcatcgtcccgacctcctga

DBGET integrated database retrieval system