KEGG   Clostridium formicaceticum: BJL90_17400Help
Entry
BJL90_17400       CDS       T05005                                 

Definition
(GenBank) catalase HPII
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
cfm  Clostridium formicaceticum
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJL90_17400
  Amino acid metabolism
   00380 Tryptophan metabolism
    BJL90_17400
Enzymes [BR:cfm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BJL90_17400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3716077..3718215)
Genome map
AA seq 712 aa AA seqDB search
MDKKQQSHTSIQKNTKNHQLEDYRKSHGEQLLTTNQGVRVSNTDDSLKAGDRGPTLMEDF
HFREKLTHFDHERIPERVVHARGFGVHGYFQVYESMAEFTKAKFLQDPSVKTPVFVRFST
VVGSRGSADTVRDVRGFATKFYTEEGNYDLVANNIPVFFIQDAIKFPDVVHAIKPEPNNE
IPQASAAHDTFWDFVVNTPETAHMIMWLLSDRAIPRSFRMMEGFGVNTFRFINHQGKARF
VKFHWKPLLGVHSLVWDEAQKLAGKDPDYHRRDLWDAINMGAYPEYELGVQMLEEEEEFN
FDFDILDPTKIWPEEIIPVRRIGKMTLDGNVDNFFAETEQVAFHPGHVVPGIDFSNDPLL
QGRLFSYLDTQLIRLGGPNFHEIPINRPVAPIHNNQRDGYHRMTIDRSSVSYSPNSLQGN
APMPASETEGGYVHYEEKVEGKKVRQRSQSFQDHYSQATLFWNSMSTAEKQHIIEAFHFE
VGSVMDKQIKQRVVDMFNNVDGQLAAQIAAGVGATPPANPGNAGITASSPAVSQENTVKD
AKTRKVAILLENGFNHQEVSQVMEALTAAGVHSEIISKNLGMLTSVDGQQLEVGKNYVTT
GSIKYDAVYIAGGQQSINTLMMQGDALHFINEAFKHAKTIGATNEGIDLLMASAIQGVAM
AGADTQAQVITEMGVITVRNVTDMKNFTKEFINGMAQHRHWIRQNKKQMIPA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaacagcagagtcatacttctatacaaaaaaatacaaaaaatcatcagtta
gaagattatcgtaaaagtcatggggagcagcttcttacaacaaatcaaggggtgcgtgtc
tccaatactgatgattctttgaaggcgggtgaccgagggccgacactgatggaggacttt
catttcagagagaagctcacccatttcgatcatgaacgaattccagaacgagtggttcat
gcccgcggttttggcgtacatggctattttcaggtctatgaatcaatggctgaatttact
aaggcaaaatttttacaagatccatcggtgaaaacccccgtttttgtgcgtttttctact
gtggtaggttctcggggttcagctgatactgttagagatgtacgaggctttgccactaag
ttttacactgaagaaggcaactatgatcttgtagcaaacaatattcccgtattttttatt
caggacgctatcaagtttcctgatgtggttcatgctattaaaccagaacctaataatgag
ataccacaggcttctgctgcccatgatactttttgggattttgtcgttaatacgccagag
acggcacacatgatcatgtggctcctatcggatagggccattccacggagtttccgtatg
atggagggttttggcgtcaatacctttagattcattaatcatcaaggaaaagctcgcttt
gttaaattccactggaagcctttattaggtgtacattccttggtttgggatgaggctcag
aagttggcgggcaaagatcctgactatcacagacgcgacctatgggatgccattaacatg
ggggcatatcctgagtacgagttaggggtacagatgttagaagaagaagaagagttcaat
tttgactttgatattcttgaccctactaaaatttggcctgaagaaattattcctgtgaga
cgaataggtaagatgacgctagatggcaacgtagataatttctttgctgaaacagagcag
gttgcatttcatcctggtcatgtggtgccagggatagattttagcaatgaccctctgtta
caaggaagactgttttcttatttagatacacagcttatccgattagggggccctaatttc
catgagattcctattaaccgacctgtagcaccaatacataataaccaaagggatggctac
catcgtatgacaattgatcgaagctctgttagttattctccaaactctcttcaggggaat
gcaccaatgccggcttcggaaacagaaggcggatatgttcattacgaagagaaagtagag
ggcaaaaaggttcgtcaacgtagccagagctttcaagatcactatagccaggctacgctt
ttctggaacagtatgtctactgcagaaaagcagcacattatagaagccttccactttgag
gtaggaagtgtgatggataaacaaatcaagcaacgggtggtagacatgtttaataatgta
gatggacaattggctgctcagattgctgctggagtcggtgctacaccgccagcaaatccg
ggtaatgctggtattacagcttcatccccagctgtaagtcaggagaacaccgttaaggat
gcaaagactaggaaggttgctatattactagaaaatggatttaatcatcaggaggtaagt
caagtaatggaggcgttaaccgctgctggcgtacattcagaaatcattagcaagaattta
ggtatgcttacaagtgttgatggccaacagttggaggttggaaaaaactacgtaaccact
ggatctatcaagtatgatgcagtctacatagctggaggtcagcaaagcataaatacttta
atgatgcagggtgatgcgctgcacttcattaatgaagcttttaagcatgcaaagacaatt
ggagctactaatgaagggatagatttgttgatggcttctgctatacaaggggtggctatg
gctggtgcagatacccaagcacaggtaataactgaaatgggtgtcataacagtaagaaat
gtcacagatatgaagaattttaccaaagaatttatcaatggcatggctcaacatcgccat
tggattcgtcaaaacaaaaaacaaatgatacctgcttag

DBGET integrated database retrieval system