KEGG   Corynebacterium falsenii: CFAL_10255Help
Entry
CFAL_10255        CDS       T03037                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cfn  Corynebacterium falsenii
Brite
Translation factors [BR:cfn03012]
 Eukaryotic Type
  Elongation factors
   CFAL_10255
 Prokaryotic Type
   CFAL_10255
Mitochondrial biogenesis [BR:cfn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CFAL_10255
Exosome [BR:cfn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CFAL_10255
  Exosomal proteins of breast cancer cells
   CFAL_10255
  Exosomal proteins of colorectal cancer cells
   CFAL_10255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2330737..2331927)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERSKPHVNIGTIGHVDHGKTTTTAAITKVLADKFPESNKSFAFDAIDKAPEEKE
RGITINISHVEYETEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEELLELVEMEVRELLGEQEYDEEAPVVHISALKAL
EGDPEWTEKILELMDACDNSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGILNL
NDEVEILGIREKSQKTTVTSIEMFNKLLDTAEAGDNAALLLRGLKREDVERGQIVAKPGA
YTPHTEFEGSVYILSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTDMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGGRTVGAGRVTKITK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggctaagttcgagcgttctaagccgcacgttaacatcggcaccatcggtcac
gtcgaccacggcaagaccaccaccactgccgctatcaccaaggttctggctgacaagttc
ccagagtccaacaagtccttcgctttcgacgccatcgacaaggcgccggaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtacgagaccgagaagcgccactacgca
cacgtcgacgctcccggccacgctgactacatcaagaacatgatcaccggtgctgcccag
atggacggcgctatcttggttgttgctgctaccgatggccccatgcctcagacccgtgag
cacgtgctgctggcacgccaggttggcgttccttacatcctcgttgcactgaacaagtgc
gacatggttgacgatgaggagctgctggagctcgttgagatggaggtccgcgagctgctg
ggcgagcaggagtacgacgaagaggctcccgttgtccacatctccgcactgaaggctctc
gagggcgatcccgagtggaccgagaagatcctcgagctcatggacgcttgcgacaactcc
atcccggatccggagcgcgagaccgacaagccgttcctgatgcccatcgaggacatcttc
accatcaccggccgcggtaccgttgttaccggccgtgttgagcgtggcatcctgaacctc
aacgacgaggttgagatcctgggtatccgcgagaagtcccagaagaccaccgttacctcc
atcgagatgttcaacaagctgctggacaccgctgaggccggcgacaacgctgctctgctg
ctccgtggcctgaagcgcgaagatgttgagcgtggtcagatcgtggctaagcccggcgct
tacaccccgcacaccgagttcgagggctccgtgtacatcctgtccaaggacgagggtggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtt
accggtgttgtgaagctgcctgagggcaccgacatggttatgcctggtgacaacgttgac
atgtccgtcaccctgatccagccggtcgctatggacgagggcctgcgcttcgctatccgc
gagggtggccgcaccgttggcgctggtcgcgttaccaagatcaccaagtaa

DBGET integrated database retrieval system