KEGG   Camponotus floridanus (Florida carpenter ant): 105250972Help
Entry
105250972         CDS       T03919                                 

Definition
(RefSeq) histone deacetylase 9 isoform X1
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105250972
Chromosome [BR:cfo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105250972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1084 aa AA seqDB search
MKVYVERASAFDRYSRAGSSKVKLVGDIHHRHATAHESMLPNVCCCYYMCVEMARDTPGS
PMPRPRNLGAGGGGGAATATLTSGAYHAAATDTANLHDHALQQKMLELQQHHHFQQQILR
QQYQAQERHLAELHEQQMHQLKLWEQQKLEEKREKDRLEALRKKDKHDHSANASTEVKQR
LQSFLVNKKQREAAAAANGAVPGTPGYRSWLQPQSESSSTTNAAHPYRMPQMLQEKFGDD
FPLRKTASEPNLLKVRLKQRVERNMAASRNSPLMARRKDRLLSHLKRKSLLANSGSNPES
GPNSPPTVNNSQASPTAGSNTAIQEEGESPAYGGRLTSSSQQGSLSDLSLFSSPSMPNIS
LGRPHVPSSSSSGTKLAPVSEAEVRAAFTARLGMPLTGQMLHGTLPFYPSLTVIEGEPAY
IHKQIQQNLQEQTAPPPSAAAGSRQHPAAAAATVYHTAPPITDTQVAHARLHKAGHRPLG
SRTQSAPLPLGHPMLQGGIIAPTTHYEEYLAEKQIHDQQQAHNYLKQQIRQTVLTRVGSR
GQANQLDEAPETEESEVIDLTGKKDHPEESEISKQQRDREQFLQQQRDLMMRHTLQTNES
TVYAGSRTSQSARPLSRALSSPLVHLGPQGNSGDMFARVSPHRPTTGLAYDPLMLKHACV
CGETVRGHPEHGGRLQSVWARLSETGLLQRCDRVRSRKASLEEIQTCHSEAHALLFGTNP
LNRQKLDMSKLSQLPIKSFVRLPCGGVGVDSDTTWNELNTAPAARMAVGCVVELAFKTAL
GDIKNGFAVVRPPGHHAETNQAMGFCFFNSVAIATRLLQQKLDVRKILILDWDVHHGNGT
QQMFYDDPRVLYLSIHRHDDGNFFPGTGGPTECGAGEGLGYNVNVAWSGGLNPPMGDAEY
LAAFRTIVMPIAKEYDPDLVIVSAGFDAAVGHPAPLGGYKVSPACFGKMTQQLLNLADGK
VVLALEGGYDLAAICDSAQECVRALLGDEPSPLRDEELARIPCQNAIDTLQKTIAIQMSH
WPCVKLTAHTVAMSAIEASQKEHDETETVSAMASLSMQQPTNLTTTPEHSREVSEEPMEQ
DEAK
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttacgtagagcgagcgagcgcgttcgatcgatattcgcgagcgggaagctcg
aaggtgaagctcgtcggcgacattcaccatcgccacgcgaccgctcacgagagcatgtta
ccgaacgtgtgttgttgttattacatgtgcgtagagatggccagggatactccgggctcg
ccgatgccgcgaccgcgaaatttgggcgccggcggcgggggaggcgcggcgacggccacc
ctgacttccggtgcttatcacgccgcagcaaccgacaccgccaacttgcacgaccacgcg
ctgcagcagaagatgctcgagctacagcagcaccatcactttcaacagcagatcctccgg
cagcaatatcaggcacaggaacgacatttggctgaactgcacgagcaacagatgcatcaa
ctcaagctctgggagcagcagaagctagaagagaaacgagaaaaggacagactggaggct
ctcaggaagaaggacaaacacgatcacagcgcgaacgcgtccacagaagtcaagcaacgc
cttcagagcttcctggtgaacaagaagcagagagaggcagccgctgcggcgaacggagct
gtacctggtacacccggatacaggagctggttgcaaccacaatctgaatcatccagcacc
acgaatgcggcgcatccatatcgaatgccgcagatgctccaggagaagttcggtgacgat
ttcccgctcaggaagacagcctcggagccgaacctgctgaaggtgcgactaaaacagcgc
gtggagaggaacatggcagcgtcgagaaactcacccctgatggcacgtcggaaggaccgc
ctgctatcgcacctcaagaggaagtcgttactagcaaattctggcagcaatcctgaatcc
gggcctaactctcctccgactgtgaacaattctcaagccagtcccactgctggaagcaac
acggcgatacaggaagaaggtgagagtcctgcgtacgggggacgtcttaccagtagtagt
cagcaaggcagcctttcggatctttcgctcttcagttcaccgtccatgcctaacatctcg
ttgggtagaccccatgtgccgtcgagctcatcgagtgggacgaaactggcgccggtttcg
gaggcggaagtccgcgccgcgttcacggcacgtcttgggatgccgctcaccggtcagatg
ctgcacggcaccctaccgttctatccgtccttgacggtcatcgaaggcgaaccggcgtac
atccacaagcagatccagcagaacctgcaggagcaaacggcgccgccgccgtccgcggca
gcgggcagcaggcagcatccggcggcggctgcggcaacggtgtatcacaccgcgccgcca
atcacggatacacaagtagctcacgcgagacttcataaggctggtcaccggcctttaggt
agtagaacccaatccgcgccactgcccctgggtcacccaatgttgcagggcgggataatc
gcaccgaccacccattatgaggaatatctcgcggagaaacaaatacacgatcaacaacag
gcacacaactatctgaaacaacagatccgtcagacggtgctaacgcgagtgggctcgcgt
ggccaagctaatcaactggacgaggcaccggaaaccgaagagtctgaggtgatagatctc
acgggaaagaaagatcatcctgaagagagcgagatctcgaagcagcagagggatcgcgaa
cagtttttgcaacagcaaagagatctcatgatgagacatacgctgcagacgaacgaatca
accgtctacgccggaagtaggacttctcaatcagccagaccgctctcgagagcgctttcg
agtcctcttgtacacttaggtcctcagggcaacagcggcgatatgttcgcacgagtttct
cctcatcgaccaactactggattagcatatgatccgttgatgctgaaacatgcgtgtgtt
tgtggcgagacggtcagaggtcatcctgaacatggtggccgattacagagcgtgtgggcc
agactctcggagacgggtctcttgcagcgttgcgatcgagtgcgctctcgcaaagcttcg
ctcgaagaaatccaaacatgccacagcgaggcgcatgcactcttattcggaacgaatcca
ttgaatcgacaaaagctagatatgtccaagctgtcgcaattacccatcaagagcttcgtt
cgacttccttgcggcggagttggcgttgattccgacacaacgtggaacgaacttaatact
gctcccgccgctcgaatggcagtaggatgcgtcgtcgaacttgcgttcaaaacggcatta
ggcgatattaagaatggcttcgctgtagtgagaccacctggacatcatgcagaaactaac
caggctatgggcttctgctttttcaattcagtggcgattgcaacgagacttctgcagcaa
aaactcgacgttagaaaaattttaatcttagattgggacgttcatcatggaaacggcacc
cagcaaatgttttacgacgacccgcgagttctgtacctgtcgatacacagacacgacgac
ggtaatttcttccctggaaccggcggacccaccgagtgcggcgccggcgagggtctcggc
tataatgtgaacgtggcgtggtccggcggtctgaatccgcctatgggcgacgcggagtat
ctcgcggcgtttcgcacgatcgttatgccgatagccaaagagtacgatccggacctcgtg
atcgtctcggccggcttcgacgcggccgtgggacatccagcgccgttgggcggttacaaa
gtcagtccggcgtgtttcggcaagatgacacagcagttacttaatttagctgacggcaaa
gtcgttctcgccttggaaggtggctatgatctggcggcaatctgcgattcggcgcaggag
tgcgtccgggcgctgcttggtgatgagcctagtccacttcgagacgaagaactcgcgaga
attccctgtcaaaacgccatcgacacgttgcagaagaccatcgccattcagatgtcacat
tggccttgcgtaaaactcactgctcatacagtcgcgatgagcgcgatagaagcaagccaa
aaagaacacgacgaaacggaaacggtatctgcgatggcctctctatctatgcagcagcct
acgaacctcacaaccacgccagaacattcccgagaggtttccgaggaaccaatggaacaa
gatgaggccaaatga

DBGET integrated database retrieval system