KEGG   Camelus ferus (Wild Bactrian camel): 102504152Help
Entry
102504152         CDS       T02979                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    102504152 (B3GALT4)
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     102504152 (B3GALT4)
Glycosyltransferases [BR:cfr01003]
 Glycan extension
  Glycolipid
   102504152 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 383 aa AA seqDB search
MPLSLFRRLLLVALLLVIVWTLFGPSGIGEELLSLSLASLVPAPASPGPPLALPRLLIPN
EKLCSGPVAPPFLLILVCTAPENLNQRNAIRASWGGLREAQGLRVQTLFLLGKPSWRHPT
GDSHGNDLARESAAQGDIMQAAFQDSYRNLTLKTLSGLNWADKHCPMACYILKTDDDVYV
NVPELVSELVRRGGHWEQQKRGMEPQKKAKVGDEKWEGGPTLGSQPVPLLYLGRVHWRVH
PSRTPGGKHQISEEQWPPTWGPFPPYASGTGYVLSASAVQLILKVASRAPPLPLEDVFVG
VSARRGGLTPTHSVKLAGATHYPLDRCCYGKFLLTSHGLDPMEMQKAWKLVDGSKGERTE
PHCSWLQGALGILRCRVIAWLYS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcagtctcttccggcgccttctcctcgtcgccctgctgttggtgattgtctgg
accctatttgggccctcaggcatcggggaagagctgctgagcctctcgctagcctccctg
gtccctgcccctgcctcgcctgggccgcccctggccctgccccgcctcttgatccccaac
gagaagctgtgtagtggtcccgttgcccctcccttcctgctaatcctagtgtgcacggcc
ccagagaacctgaaccagagaaatgccattagggcctcatggggcggcctacgcgaggcc
caagggctcagggtgcagactctctttctactggggaagccaagctggcgccatcccacc
ggggactcccacgggaacgacctggcacgcgagtcagcggcccagggggacatcatgcag
gcggccttccaggattcctaccgcaacctcaccctcaagaccctcagtgggctcaactgg
gcggacaaacactgccccatggcctgctacatcctcaaaactgacgatgacgtgtatgtc
aacgtcccggaactggtatcagagctggtccggcgagggggccattgggagcaacagaag
aggggcatggagccccagaaaaaggctaaggttggagatgaaaagtgggaaggaggcccc
accttggggagccagccagtgcctcttttgtatttgggccgtgtgcactggcgggtgcac
ccctctcggacaccagggggcaagcaccagatatcagaggagcagtggcctcccacctgg
ggcccctttcccccctatgcctcaggcacaggttatgtgctgtcagcttctgccgtgcag
ctcatcctgaaggtggccagccgggcaccccctctgcctctggaggatgtctttgtggga
gtaagtgcccgacgaggaggcctcaccccaacccactctgtcaagctggctggtgcgacc
cactaccctctggaccggtgctgctatgggaaattcctgctgacatcccacgggttggat
cccatggagatgcagaaagcctggaagctggtggatggctctaagggtgaaagaactgaa
ccccactgctcctggctccagggagcactaggcatcctgcggtgtcgggtaatagcctgg
ctttacagctga

DBGET integrated database retrieval system