KEGG   Camelus ferus (Wild Bactrian camel): 102511249Help
Entry
102511249         CDS       T02979                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102511249 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102511249 (GYS1)
   04152 AMPK signaling pathway
    102511249 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102511249 (GYS1)
   04922 Glucagon signaling pathway
    102511249 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102511249 (GYS1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102511249 (GYS1)
Glycosyltransferases [BR:cfr01003]
 Polysaccharide
  Storage polysaccharide
   102511249 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGSPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDVPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSSGGSKRGSVDTAPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctcactgccaggactggaggattgggaagat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacggtgctgcagacgaaggcgaaggtgacaggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaacttctc
gagcccccgaccccggccctgaagaggacgctggactccatgaacagcaagggttgcaag
gtgtatttcgggcgctggctgatcgaggggagccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggcgagctgtgggacacgtgcaacatcggg
gtgccctggtacgaccgggaggctaacgatgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacatgtggttgcgcacttccat
gagtggttggcgggcgtcgggctctgcctgtgccgtgcccggcggctgcctgtggctaca
atcttcaccacccatgccacgctgctggggcgatacctatgtgccggtgctgtggacttc
tacaataacctggagaatttcaatgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcagcccactgcgctcatgtcttcactaccgtgtcccag
attaccgccatcgaggctcagcacctgctcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgaattccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtacttctttattgctggccgctatgagttctccaacaagggggctgat
gtcttcctggaggctttggcccggctcaactatctgctcagagtgaacggcagcgagcag
acagtggtcgccttcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctg
aagggccaagccgtgcgcaagcagctttgggatacagccaacacagtgaaggagaagttt
gggaggaaactttatgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggatttcactatgatgaagagagccatctttgccacacagcggcagtctttt
ccccctgtgtgcacccacaatatgctggatgactcctcggaccctatcttgactaccatc
cgccgaattggcctcttcaatagtagtgccgacagggtcaaggtgatttttcacccagag
ttcctctcctccacaagccccctgctccccgtggactatgaagagtttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacgccagctgagtgcacg
gtcatgggtatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggcatctacatcctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcattatccagcggaaccgcacggagcgcctctctgatcttctggactggaaatac
ctaggccggtactacatgtccgcgcgccacatggcactggccaaggcctttccggaacac
ttcacttacgagccccacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcactgtcacgacactcgagcccgcaccagagcgaggatgag
gaggagcccagggatgtaccacccgatgaagacggtgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaatatccgcgctcctgagtggccgcgccgcgcctcctgcacc
tcttcctctggcgggagcaagcgcggctcggtggacacagcgccctccagctcactgagc
acccccagcgagcccctcagccctgccagttccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system