KEGG   Camelus ferus (Wild Bactrian camel): 102511313Help
Entry
102511313         CDS       T02979                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102511313 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102511313 (GYS2)
   04152 AMPK signaling pathway
    102511313 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102511313 (GYS2)
   04922 Glucagon signaling pathway
    102511313 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102511313 (GYS2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102511313 (GYS2)
Glycosyltransferases [BR:cfr01003]
 Polysaccharide
  Storage polysaccharide
   102511313 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 702 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEAQLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGD
NYFLIGPYFEHNMKTQVEQCEPVNDAIGRAMSTMNKHGCQVHFGRWLIEGSPYVVLFDIG
YSAWNLDKWKGDLWEACSVGIPYHDQEANDMLIFGSLTAWFLKEVTDHADGKHVIVQFHE
WQAGTGLILSRAQKLPIATVFTTHATLLGRYLCAANTDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMYK
ARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDVT
VVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNTILD
RDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNGRTDRVKVILHPEF
LSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEH
VADPAAYGIYIVDRRFCSLDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYQHARHLTLSRAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQSSDGED
EHEDDRYDEEEEAERDRLNIKSPFTLGRVPHGKKKLHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggtcgatccctgtctgtcacgtccctggggggactgcctcggtgggaagct
caacttcctgtggaggatttactgctctttgaagtcgcttgggaagtgaccaataaagtt
ggtggcatctatactgtgattcagacaaaggccaaaacaactgcagatgaatggggagac
aattattttctgattggtccgtattttgagcataatatgaagactcaggtggaacagtgc
gaacctgtgaatgatgccattgggagagccatgagcacgatgaataaacacggctgccag
gtgcactttgggagatggctgatagaagggagtccttatgtggtgctctttgacataggc
tactcggcttggaacctggacaagtggaagggtgacctctgggaagcctgcagcgtcggc
atcccttatcacgaccaggaagctaacgatatgctgatatttggatcattaactgcctgg
ttcttaaaagaggtgacagatcacgcagatgggaaacacgtcattgtccagttccatgaa
tggcaggccggaaccggactgatcctttctcgagctcagaagcttccaatcgccacagtc
ttcaccacgcacgccacactgcttgggaggtatctctgtgcagcaaacactgatttctac
aaccatcttgataagtttaacatagacaaagaggctggggagaggcagatttaccaccgg
tactgcatggagcgggcttctgtccactgtgctcatgtgttcaccacagtttccgaaata
acagcgatcgaggcagagcacatgctgaagagaaagcctgatgtaattactccaaatggc
ttgaatgttaagaaattttcagcagtacatgaatttcaaaatctacatgccatgtacaag
gccaggatccaagattttgttcgaggtcatttttatggtcacctggactttgatcttgaa
aaaacgttgttcctcttcattgctgggaggtatgaattttcaaacaaaggagctgacatc
ttcctagaatccttatccaggctcaatttcctgctgaggatgcataaaagtgacgtcacc
gtggtggtgtttttcatcatgcctgccaagacaaataatttcaatgtggaaaccctgaaa
ggccaggcagtgcgaaaacagctctgggacactgcgcattctgtgaaggaaaagtttgga
aagaaactgtacgatgcattgttaagaggagaaattcctgacatgaacaccattttggat
cgagatgatctaacaattatgaaaagagccatcttttcaactcagcggcagtccttgccc
ccagtgaccactcacaacatgattgatgactccaccgatcccatcctcagcaccattaga
cggatcgggcttttcaacggccgcacagacagagtcaaggtgattttgcatccagagttc
ctatcctccaccagccccttgttacccatggattatgaagagtttgtccgcggttgtcat
cttggtgtatttccatcatactatgagccctggggttatactccagccgaatgcaccgtg
atgggtatccccagcgtaaccaccaacctctccggctttggctgtttcatgcaggagcac
gtggctgatcctgctgcatatggtatttacattgttgacaggaggttctgctctctggat
gattcttgcaatcagctgaccaagtttctctatggattttgcaaacagtcacgccgccag
aggattattcagaggaaccgaaccgagaggctctcggaccttctggattggagatactta
ggcagatattaccagcatgccaggcacctgacattaagcagagcttttccagataaattc
cacatggaacccacatcaccacccacgacagaagggtttaaataccccaggccttcctcg
gtcccaccttctccttcggggtcccaggtctccagtcctcagagcagtgatggggaggat
gagcatgaggatgacagatacgatgaggaagaggaggcggaaagggatcggttaaatatc
aagtccccatttactctgggtcgtgttcctcacggaaagaagaagctgcacggcgaatac
aagaactga

DBGET integrated database retrieval system