KEGG   Camelus ferus (Wild Bactrian camel): 102514903Help
Entry
102514903         CDS       T02979                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102514903 (SETDB2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102514903 (SETDB2)
Chromosome [BR:cfr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102514903 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102514903 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 705 aa AA seqDB search
MGEKNGDAKTFWMGLEDDGKVDFIFEQVQNVLQSLKRKIKDGSATNKEYIQAMVLVNEAT
INNNSTLIKGHTSVAENAQEKKSRSLPSTSYEDSFPEDRTSLPTENKETPPLENKIADFR
EKESSSNLSYRSHACSGACLMKMPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNEEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPLFKYRKTMWPRAYYLNSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNARTCPLSSNKITTGYKYKRLLRQIPTGIYECSLLCKCNRRMCQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNTDKPDAIEENGKEENITKNMFSKKRKI
EVADCEVEVIPLELETHPGSAVTEACPPKLHLHPKEPTAEMKCNNVSRIQYHSVIRSPKT
KTTIIQHNGKKTGFTSSESVTSEDTGGFKSTQLHLNSKAKEMRKDSSSNQVEDSEDNLWI
ESDVIDITKCREETPPGGRCNQAVTLDNQNVTKDFKVQIQKLQEEKSAACQNQQVFCDKN
LPSETKNASSDSLKKFSKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPL
VAFFTNRYVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggggctggaagatgatggaaaa
gtggatttcatatttgaacaagtgcaaaatgtactgcagtcactgaaacgaaagatcaaa
gatgggtctgccacaaataaagaatacatccaagcaatggttctagtgaatgaagcaact
ataaataacaattcaacattgataaagggtcacacgtctgtggccgagaatgcacaggaa
aagaaatcaaggtcattgccatctacgtcatatgaagactcctttccagaagaccgtacc
tctctacctacagaaaataaggaaactccccctctggaaaataaaattgcagactttaga
gaaaaagaatcatcttcaaatttatcttaccgaagtcatgcctgctctggtgcctgtctg
atgaaaatgccgctaaccttcaagggagaaaaccctttgcagctaccaatcaaatgccac
ttccaaagacgacatgcgaagacaaactctcattcttcagcactccacgtgagttataaa
accccttgtggaaggagtctacgaaacgaggaggaagtttttcgttacctgcttgagaca
gagtgtaactttctatttacagataacttttctttcaatacctatgttcagttgactcgg
aattacccaaagcaagaagaaattgtttctgatgtggatattagcaatggagtggaatca
gtgcccatttctttctgtaatgaaattgacaatagaaagcttccactgtttaagtacaga
aagactatgtggccacgagcatattatctaaacagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataactaaatgtgcatgtcttcaactgacagca
aggaatgccaggacttgccccttgtcaagtaataaaataaccactggatataaatataaa
agactactgagacagatacctactggcatttatgaatgtagcctgttgtgcaaatgtaat
cggcgaatgtgtcaaaaccgagttgtccagcatggacctcaagtgaggctgcaagtgttc
aaaactgagaagaaaggatggggagtacgttgtcttgatgacattgacagagggacattt
gtttgcatttattcaggaagattactaagcagatctaacaccgacaaacctgatgctatt
gaagaaaatggaaaagaagagaatattacgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggttgaagttatcccgttagaattggaaacgcatcccggaagc
gctgtgactgaggcatgtccacctaagctccaccttcatcccaaggaacctactgcagaa
atgaaatgtaacaatgtttcaagaattcaatatcattcagtcattagaagtcctaaaacc
aagacgaccattattcaacacaatgggaaaaagacgggatttacttcctcagagtctgta
acctcagaagatactggtggatttaaatcgacccagctacatctgaactctaaagccaag
gaaatgagaaaggactcaagctcaaatcaagttgaagattctgaagacaacctttggatt
gaatcagatgtgatagatataacaaaatgtagagaagaaactccaccagggggcagatgt
aaccaggcagtcacactggataatcagaatgttacaaaggattttaaggttcaaatacaa
aaactccaagaggaaaaatccgcggcatgtcaaaaccagcaagtcttttgtgataaaaat
ttgccaagtgaaaccaagaatgcttcgtctgattctctaaagaagttcagtaaagggaat
gtgtttttattggatgccacaaaagaaggaaacgtgggccgcttccttaatcatagctgt
tgcccaaatcttttggtacagaatgtttttgtagaaacacatgacagaaattttccattg
gtggcgttcttcaccaacaggtatgtgaaagcaagaacagaactaacatgggattatggt
tatgaagctgggactatgcctgagaaagaaatcctctgccaatgtggggttaataagtgt
aggaaaaaaatattataa

DBGET integrated database retrieval system