KEGG   Camelus ferus (Wild Bactrian camel): 102522368Help
Entry
102522368         CDS       T02979                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04146  Peroxisome
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    102522368 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    102522368 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    102522368 (SOD2)
   04213 Longevity regulating pathway - multiple species
    102522368 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    102522368 (SOD2)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102522368 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102522368
NCBI-ProteinID: XP_014409968
LinkDB All DBs
Position
Un
AA seq 176 aa AA seqDB search
MQLHHSKHHAAYVNNLNVAEEKYQEALEKGDITAQVALQPAIKFNGGGHVNHSIFWTNLS
PNGGGEPKGELLEAINRDFGSFSKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVISWENVTQRYLACKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaagcaccacgcggcctacgtgaataacctgaatgtcgccgag
gagaagtatcaggaggcgctggagaagggtgacattacagctcaggtagctctgcagccg
gcaataaagttcaacggtggaggccatgtcaatcattccattttctggacaaacctgagt
cctaatggtggaggagaacccaaaggggaattactggaagccatcaaccgtgactttggt
tccttcagcaaatttaaggagaagttgaccgctgtatccgttggcgtccaaggctcgggt
tggggttggcttggtttcaataaggaacagggacgcttacagattgctgcttgttctaac
caggatcccttgcaaggaacaacaggtcttattccattgctgggaattgatgtgtgggag
cacgcttactaccttcagtataaaaatgttagacctgattacctgaaagctatttggaat
gtaatcagctgggagaatgtaactcagagatacctggcgtgcaaaaagtag

DBGET integrated database retrieval system