KEGG   Camelus ferus (Wild Bactrian camel): 102523245Help
Entry
102523245         CDS       T02979                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00480  Glutathione metabolism
cfr00980  Metabolism of xenobiotics by cytochrome P450
cfr00982  Drug metabolism - cytochrome P450
cfr00983  Drug metabolism - other enzymes
cfr01524  Platinum drug resistance
cfr05200  Pathways in cancer
cfr05204  Chemical carcinogenesis
cfr05225  Hepatocellular carcinoma
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102523245 (GSTO1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102523245 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102523245 (GSTO1)
   00983 Drug metabolism - other enzymes
    102523245 (GSTO1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102523245 (GSTO1)
   05204 Chemical carcinogenesis
    102523245 (GSTO1)
   05225 Hepatocellular carcinoma
    102523245 (GSTO1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102523245 (GSTO1)
  Drug resistance
   01524 Platinum drug resistance
    102523245 (GSTO1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102523245 (GSTO1)
Transporters [BR:cfr02000]
 Other Transporters
  Pores ion channels [TC:1]
   102523245 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 102523245
NCBI-ProteinID: XP_006183058
LinkDB All DBs
Position
Un
AA seq 240 aa AA seqDB search
MSRPSARSLGKGSAPPGPVPVGLIRVYSMRFCPFAQRTLLVLKAKGIRHEVININLKNKP
EWFFKKNPLGLVPVLENSRGQVICESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELF
SKVPPLVKDSVRWQKKENISGLEELRKEFSKLDEVLANKETTFFGGNSPSLIDYLIWPWF
ERLEAMELNECIDHTANLKLWMAAMMKDPAVASLYIEPSTHQQFFRLYLQDSPEACDCGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaccatcagccaggagcctggggaagggaagcgcgcccccagggccggtcccc
gtgggcctgatccgcgtctacagtatgagattctgcccttttgcccagaggacactcctg
gtcctgaaggccaagggaattcggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttcttcaagaagaatccccttggtctggtgccggttctggaaaacagtcggggt
caagtgatctgcgaatctgccatcacctgcgagtacctggatgaagcatatccggggaag
aagctgttgccagatgatccctatgagaaagcttgccaaaagatggtctttgagttgttt
tctaaggtaccacctttggtaaaagactctgttagatggcaaaagaaggaaaacatctct
ggcttagaagaactgcgtaaagaattcagcaagctagatgaggtcctggccaataaggag
acaaccttctttggtggtaattctccttccctgattgattacctcatctggccctggttt
gaacggctggaagccatggagttaaatgagtgtattgaccacactgcaaatcttaagctc
tggatggcagccatgatgaaagatcccgcagtagcatcactttacattgaaccgagcacc
catcaacaatttttccgcctctacttgcaggacagccctgaggcctgtgactgtgggctc
tga

DBGET integrated database retrieval system