KEGG   Collimonas fungivorans: CFU_2131Help
Entry
CFU_2131          CDS       T01583                                 

Gene name
gst4
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CFU_2131 (gst4)
Enzymes [BR:cfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CFU_2131 (gst4)
Transporters [BR:cfu02000]
 Other Transporters
  Pores ion channels [TC:1]
   CFU_2131 (gst4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AEK61961
UniProt: G0AGV6
LinkDB All DBs
Position
complement(2490162..2490794)
Genome map
AA seq 210 aa AA seqDB search
MMKLYGFAATRSIRVLWALNELNAEFEFVPVNILAGEHHRPEFLRINPAGKVPALVDGDV
VLTESAAIVMYLAEKYPDRGLLPADPKQLAQAYRWVMFAMTELEQPLWRITRHTWLYPEE
QRIPAEIPVASQEFIAMATILDSHMAGRQFIVGDTVTIADCVTAYLMDWANEYHLIDEHP
RLRTYLDRMYARPTAPLRIAEAFANLQLEN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactctatggatttgccgccacccgctcaattcgcgtactgtgggcattaaac
gagctcaatgccgagttcgagtttgtgccggtcaatatcctggcgggagaacatcatcgt
ccggaattccttcgcatcaaccccgccggtaaggtgcccgcgctggtcgacggcgatgtg
gtgctgaccgaatccgcggcgattgtcatgtacctggctgaaaaataccctgatagaggg
ctgcttcctgccgaccccaagcaactagcccaagcgtatcgctgggtaatgtttgccatg
acagaactggagcagccgttgtggcgcatcacacgccatacctggttatacccggaagag
caacggatacctgcggaaatccctgtcgccagccaggaattcattgccatggcgaccata
ttggatagtcacatggcaggacggcagttcatcgtcggcgacaccgtcaccatagccgat
tgcgtgacggcgtacctgatggactgggccaatgaatatcacctgatcgatgaacacccg
cgactgcgtacttacctggacagaatgtacgcccgccccactgctcccctgcggattgcc
gaagcgtttgccaatcttcaattggaaaattga

DBGET integrated database retrieval system