KEGG   Cystobacter fuscus: CYFUS_003871Help
Entry
CYFUS_003871      CDS       T05065                                 

Definition
(GenBank) D-alanine-D-alanine ligase/ATP-grasp enzymes-like protein
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cfus  Cystobacter fuscus
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfus00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CYFUS_003871
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CYFUS_003871
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CYFUS_003871
Enzymes [BR:cfus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CYFUS_003871
Peptidoglycan biosynthesis and degradation proteins [BR:cfus01011]
 Precursor biosynthesis
  Amino acid ligase
   CYFUS_003871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4752038..4754224
Genome map
AA seq 728 aa AA seqDB search
MRIALTYNLKLSDSEEEAEFDSQETVNTLAAAIERLGHRLERFEVSGPASRTVARLEAYS
PDLIFNIAEGRRGRFREAFYPALFEELGFAYTGSDAYALAVTLDKQLTKLVLSKHGIRTP
GWQFVEHLNELKVEELRFPVIIKPNFEGSSKGITQDSVAETVEEARTKVAHALSRYPNGV
LVEEFIRGTDITVPYLAAVQNDHDGVLSPVSYDIDPAAIAGRKYDIYDYELKTKRESAVK
VRAPARLPVKMVEELRAASKKIIAVLDCRDLGRIDFRLSDAGVPYFLELNALPSLEQGAG
IYASAALEGVHLDGVVNAIIQSAARRYKIKDGRRQGKPARKTGPLRVGFTYNVKRVKPTA
EPGATEDSEAEYDSPTTLQAIREAIASWGHEVVDLEATAELPSVLASTPLDIVFNIAEGF
KGRNRESQVPAMLELLDIPYTGSDPATLSIALDKALAKKIVRQAGIHTPIFQLMHTGKER
LNKEFTTFPLIVKPVAEGSSKGVVSKSVCGNEAELREVVKEIVTKYQQPALIEEYIGGRE
FTVGLLGERRPRVLPPMEIVFLDKAEKNPIYSFQHKLDWNDRIRYDAPAKLEPALLEKLR
AAARGSFMALGCRDVARIDFRMDDKGRLYFIECNPLPGLTPGWSDLVLIAQGAGMDYRGL
IGEIMAPAIRRYKEREARRAADESALMKLAMEKAAQEKGTPSEDKSTGNGSGGGGSSSEA
SPRMEMKA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgcgctgacgtacaacctcaagctgtccgactcggaagaagaggcggagttc
gactcccaggagacggtgaacacgctggccgcggccatcgagcggctcggccaccggctg
gagcgcttcgaggtgagtggacccgcctcgcgcaccgtggcccgcctggaggcctacagc
ccggatctcatcttcaacatcgccgagggccgccggggccgcttccgcgaggccttctat
cccgcgctcttcgaggagctgggcttcgcctatacgggctcggacgcctacgcgctggcc
gtcaccctggacaagcagctcaccaagctggtgctcagcaagcacggcatccgcaccccg
ggctggcagttcgtcgagcacctcaacgagctgaaggtcgaggagctgcgctttcccgtc
atcatcaagcccaacttcgagggctcctccaagggcatcacccaggactcggtggccgag
accgtcgaggaggcccggacgaaggtggcccacgccctctcgcgctaccccaatggcgtg
ctggtggaggagttcatccggggcaccgacatcaccgtgccgtacctcgcggcggtgcag
aacgatcatgacggcgtgctcagcccggtgtcctacgacatcgatccggccgccatcgcc
gggcgcaagtacgacatctacgactacgagctgaagacgaagcgcgagagcgccgtcaag
gtgcgtgccccggcccggctcccggtgaagatggtcgaggagctgcgcgcggcgtccaag
aagatcatcgccgtgctcgactgccgggacctggggcgcatcgacttccggttgagcgac
gcgggcgtgccctacttcctggagctcaacgcgctgccgagcctggagcagggcgcgggc
atctacgcctccgccgcgctggaaggcgtgcacctggacggcgtcgtcaacgccatcatc
cagagcgcggcgcggcgctacaagatcaaggacggccggcgccagggcaagcccgcgcgc
aagacgggccccctgcgcgtgggcttcacctacaacgtcaagcgcgtgaagcccacggcc
gagcccggagccaccgaggacagcgaggccgagtacgactcgcccaccacgctgcaggcc
atccgcgaggccatcgcctcgtggggccacgaggtggtggacctggaggccacggcggaa
ctgcccagcgtgctcgcgagcaccccgctggacatcgtgttcaacatcgccgagggcttc
aagggccgcaaccgcgagagccaggtgcccgcgatgctggagctgttggacatcccctac
acgggcagcgatccggccacgctctccatcgcgctggacaaggcgctggcgaagaagatc
gtccgtcaggccggcatccacacgcccatcttccagctcatgcacacgggcaaggagcgg
ctcaacaaggagttcaccaccttcccgctcatcgtgaagccggtggcggagggctcctcc
aagggcgtggtgagcaagagcgtgtgcggcaacgaggcggagctgcgcgaggtggtgaag
gagatcgtgacgaagtaccagcagcccgcgctcatcgaggagtacatcggcggacgcgag
ttcaccgtgggcctgctcggcgagcggcgcccgcgcgtgctgccgccgatggagatcgtc
ttcctggacaaggcggagaagaaccccatctacagcttccagcacaagctggattggaac
gatcgcatccgctacgacgcgccagcgaagctggagcccgcgctgctggagaagctgcgc
gcggcggcgcgcggctcgttcatggcgctggggtgccgggacgtggcgcgcatcgacttc
cgcatggacgacaagggccggctgtacttcatcgagtgcaacccgctgccgggcctgacg
ccggggtggagcgacctggtgctcatcgcccagggggcgggcatggactaccgggggctc
atcggggagatcatggccccggccatccgccgctacaaggagcgcgaggcccggcgtgcc
gcggacgagagcgccctgatgaagctggcgatggagaaggccgcccaggagaagggcact
ccgtccgaggacaagtccactgggaacgggagtgggggagggggctcctccagtgaggct
tcgcctcgcatggagatgaaggcctga

DBGET integrated database retrieval system