KEGG   Campylobacter fetus subsp. venerealis 97/608: CFV97608_0873Help
Entry
CFV97608_0873     CDS       T03351                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cfx  Campylobacter fetus subsp. venerealis 97/608
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFV97608_0873 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFV97608_0873 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CFV97608_0873 (ddlA)
Enzymes [BR:cfx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFV97608_0873 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cfx01011]
 Precursor biosynthesis
  Amino acid ligase
   CFV97608_0873 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
869274..870311
Genome map
AA seq 345 aa AA seqDB search
MKFGIVFGGVSFEHEISIVSAIAVKKALKCELSFIFVDKFGDFYLINSDDMRANFFSSHK
YKNSKKLHLKKGGFAAHGIFGMNDLNVDCYINLIHGRDGEDGKIAGMFEFYNVTFIGPRL
EASVMSFNKELTKLLAHKCAVKSLPYEMIKRGDIVKTELPFILKPARLGSSIGVSVVRDI
SNLDYALDVAFEFDKDILVEPFKEGIREFNLAGFKAENDFIYSFIEEPKKNDFLDFEQKY
MSFSSSCAKEADIDDSLKIEIKDAFAKIYNGGNFDGALIRCDFFVLDNEVYLNEINPNPG
SMANYLFTDFTSSVEKLANSIKPSKNIDIDYKFINSITSNKGKLA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttggtatagtatttggcggagtgagttttgaacatgagataagcatagtctcg
gccatagcggtaaaaaaggctttaaagtgcgaacttagttttattttcgtagataaattc
ggagatttttatcttataaatagtgacgatatgagagcaaatttttttagcagtcataag
tataaaaactcaaaaaaacttcatctaaaaaaaggtggttttgcggctcacgggatattt
ggtatgaatgatctaaacgtggattgctatataaatttaatacacggcagagatggcgaa
gacggcaaaatagccggtatgtttgagttttataacgtaacttttattggccctagatta
gaagctagcgtgatgagtttcaacaaagaactcacaaaactattagctcataaatgcgct
gtaaaatctcttccttatgagatgataaaaagaggcgatatagttaaaaccgaacttcct
tttatactaaaaccagcaagacttggaagtagtataggcgtgagcgttgttagggatatt
tcaaatttagattatgcgttagacgtggcatttgagtttgataaagatatcttagtagag
ccttttaaagaaggtataagagagtttaatttagcaggatttaaagccgaaaatgatttt
atatactcttttatagaagagccaaaaaagaatgattttttagattttgaacaaaaatat
atgagtttttctagtagctgtgcaaaagaagccgatatagacgatagtctaaaaatagag
ataaaagacgcttttgctaaaatttataatggcggaaattttgacggagctttgataaga
tgtgatttttttgttttagataatgaagtttatctaaatgagataaatccaaatcccggt
agcatggcaaactatttatttaccgactttacgtcatctgtagaaaaattggcaaattct
ataaaaccatcaaaaaatatagatatagactataaatttattaattctataacaagcaat
aaaggtaagctagcataa

DBGET integrated database retrieval system