KEGG   Cellulomonas gilvus: Celgi_1195Help
Entry
Celgi_1195        CDS       T01537                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cga  Cellulomonas gilvus
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Celgi_1195
  Energy metabolism
   00680 Methane metabolism
    Celgi_1195
Enzymes [BR:cga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Celgi_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1315226..1317919
Genome map
AA seq 897 aa AA seqDB search
MAYVERVTAPLLPRDVPRGLASHEVPEPLRNDVRVLGEFLGRVLRESVGDDLLADVERLR
ELAIKAHDDPESDALARAEELVAGFTLTRAEQVARAFTCYFHLANTAEEYHRVRVLRERE
AHADPHALTPDDSLPAALAQLSDEVGPDEARRRLQEAEFRPVLTAHPTEARRRAVSRSIR
RIAELVAERDVRSVGGMSLAENDRRLLAEIDTLWRTAPLRQAKPSVLDEVRTVLSVFEST
LADVLPAVYRRLDDWILDGEAGTTPPVVRPFARLGSWIGGDRDGNPNVTAEVTRAAAQLA
SEQVLVALEQSARRTAAGLTLDATGTPPSSELNALWQRQRSLSEEIASRVAADSPNEPHR
RELLFVVERLGATRGRNADLAYGSSAELEADLLVVQRSLVAGGATRQAFGDLQRLLWQVQ
TFGFHLAELELRQHSQVHEGALADIEAHGIDGELEPRTVEVLDTFRTIGTIQKRFGPEAA
RRYIVSFTQSAEHLAAVYRLAELAYGGPENVPVIDAIPLFETFADLEASVDILQGALELP
QVRKRLAENGRRVEVMLGYSDSSKDVGPVSATLALDDAQRRITAWARENDIVLTLFHGRG
GALGRGGGPANRAVLAQPPGSVDGRFKLTEQGEVIFARYGDAHIAARHIEQVVAATLLAG
APSVEKRNADAAERFAGLAARLDEASRTHFHALVRADGFPQWFSAVTPLEEIGLLPIGSR
PARRGLSVSSLDDLRAIPWVFSWSQARINLAGWYGLGTALEQVDDLAELRAAYAQWPLFG
TMIDNVEMSLAKTDERIAARYLELGDRDDLARAVLDEMARTRRWVLAITESDAMLSRRRI
LGRAVQLRSPYVDALSLLQLRALRGLRTGDAVEHADDLRRLLLLTVNGVAAGVQNTG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
gtggcctatgttgagcgcgtgacagcaccgctccttccccgtgacgtcccgcgaggcctg
gccagccatgaggtgccggagcccctgcgcaacgacgtgcgcgtgctcggcgagttcctg
ggccgcgtgctgcgcgagtccgtcggtgacgacctgctcgccgacgtcgagcgcctgcgc
gagctcgccatcaaggcgcacgacgacccggagagcgacgcgctggcgcgtgcggaggag
ctcgtcgcgggcttcacgctcacgcgtgccgagcaggtggcgcgcgcgttcacgtgctac
ttccacctggccaacacggccgaggagtaccaccgggtgcgcgtgctgcgcgagcgtgag
gcgcatgccgacccgcacgcgctcacgcccgacgactcgctgccggccgcgctggcccag
ctctccgacgaggtcgggcccgacgaggcacggcgtcggctgcaggaggccgagttccgc
ccggtgctgaccgcccacccgaccgaggcgcgacggcgtgcggtgtcccgctcgatccgc
cgcatcgccgagctggtggccgagcgcgacgtccgttcggtggggggcatgtcgctcgcg
gagaacgaccgtcgcctgctggcggagatcgacacgctgtggcgcacggcgccgctgcgc
caggccaagcccagcgtgctcgacgaggtccgcacggtcctgtcggtgttcgagtcgacg
ctcgcggacgtgctgccggccgtctaccgccgcctggacgactggatcctcgacggcgag
gccggcacgacgccgcccgtggtgcgccccttcgcacgcctgggctcgtggatcggcggc
gaccgcgacggcaaccccaacgtcacggccgaggtcacgcgcgccgccgcgcagctcgcg
tccgagcaggtgctcgtggcgctcgagcagtcggcgcgtcgcacggcggcgggcctgacg
ctcgacgcgaccggcacgccgccgtcgtccgagctcaacgcgctgtggcagcgccagcgc
tcgctctccgaggagatcgcgagccgcgtcgcggccgactcgcccaacgagccgcaccgg
cgcgagctgctgttcgtcgtcgagcggctcggggcgacccgcggccggaacgcggacctg
gcgtacggctcgtcggccgagctcgaggccgacctgctggtggtgcagcgctcgctcgtc
gcgggcggcgccacgcgccaggcgttcggcgacctgcagcgcctgctgtggcaggtgcag
acgttcggcttccacctggccgagctcgagctgcggcagcactcgcaggtgcacgagggt
gcgctcgcggacatcgaggcgcacggcatcgacggcgagctcgagccgcgcacggtcgag
gtgctggacacgttccgcaccatcggcacgatccagaagcgtttcgggcccgaggcggcg
cggcgctacatcgtgtcgttcacgcagtcggccgagcacctcgcggcggtgtaccgcctc
gcggagctcgcgtacggcgggccggagaacgtgccggtgatcgacgcgatcccgctgttc
gagacgttcgccgacctcgaggccagcgtcgacatcctgcagggcgcgctcgagctcccg
caggtgcgcaagcggctcgcggagaacggccggcgcgtcgaggtcatgctcggctactcg
gactcgtcgaaggacgtcggcccggtctcggccacgctcgcgctcgacgacgcgcagcgc
cggatcacggcgtgggcccgcgagaacgacatcgtcctgacgctgttccacggccgcggc
ggcgcgctgggccgcgggggcggccccgccaaccgtgcggtgctcgcgcagccgccgggc
tcggtggacggccggttcaagctgaccgagcagggcgaggtgatcttcgcgcggtacggc
gacgcgcacatcgcggcgcggcacatcgagcaggtggtcgccgcgacgctgctcgcgggt
gcgccgagcgtcgagaagcgcaacgcggacgcggccgagcggttcgcgggcctcgccgca
cgtctcgacgaggcgtcgcgcacgcacttccacgcgctggtccgggccgacgggttcccg
cagtggttctcggccgtgacgccgctcgaggagatcggcctgctgccgatcggctcgcgc
cctgcgcgccgcggcctgtccgtctcgagcctggacgacctgcgggcgatcccgtgggtg
ttctcctggtcgcaggcgcgcatcaacctcgccggctggtacgggctgggcaccgcgctc
gagcaggtcgacgacctggccgagctgcgtgcggcgtacgcgcagtggccgctgttcggc
acgatgatcgacaacgtcgagatgtcgctggccaagacggacgagcggatcgccgcgcgg
tacctggagctgggggaccgcgacgacctggcccgcgccgtgctggacgagatggcgcgc
acgcggcggtgggtgctggcgatcaccgagtccgacgcgatgctctcgcggcggcggatc
ctgggccgcgccgtgcagctgcgcagcccgtacgtggacgcgttgtcgctcctgcagctg
cgcgcgctgcggggcctgcgcacgggcgacgcggtcgagcacgccgacgacctgcgccgc
ctcctgctgctcaccgtcaacggcgtggccgcgggcgtccagaacaccggctga

DBGET integrated database retrieval system