KEGG   Cellulomonas gilvus: Celgi_1420Help
Entry
Celgi_1420        CDS       T01537                                 

Definition
(GenBank) Manganese/iron superoxide dismutase-like protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cga  Cellulomonas gilvus
Brite
Enzymes [BR:cga01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Celgi_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1551211..1551840)
Genome map
AA seq 209 aa AA seqDB search
MADYTLPDLPYDYAALEPHISGRIMELHHDKHHAAYVTGANTALEKLAEARQSGDLAAVN
LHEKNLAFNLGGHVNHSVFWQNLSPEGGDKPTGELAAAIDEFFGSFDAFQKHFAANAVGI
QGSGWSILGWDSVGQKLAIFQLYDQQSNFPLGLVPIVVLDMWEHAFYLDYVNVKADYVKA
WWNIVSWSDAAARFERARSQTSGLIVPTV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgactacacgcttccggacctgccgtacgactacgcggcgctcgagccgcacatc
tccggccggatcatggagctgcaccacgacaagcaccacgccgcgtacgtgaccggcgcc
aacacggccctggagaagctcgccgaggcgcgccagtccggggacctggccgcggtcaac
ctgcacgagaagaacctggcgttcaacctgggtggtcacgtcaaccactcggtcttctgg
cagaacctgtcccccgagggcggcgacaagccgaccggtgagctcgccgcggcgatcgac
gagttcttcggctcgttcgacgcgttccagaagcacttcgccgcgaacgcagtcggcatc
cagggctccggctggtccatcctcggctgggactccgtgggccagaagctcgcgatcttc
cagctgtacgaccagcagagcaacttcccgctcggcctcgtgccgatcgtcgtgctcgac
atgtgggagcacgcgttctacctggactacgtcaacgtcaaggccgactacgtcaaggcg
tggtggaacatcgtcagctggtccgacgcggccgcccgcttcgagcgtgcgcggagccag
acctcgggcctgatcgtccccaccgtctga

DBGET integrated database retrieval system