KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0587Help
Entry
cg0587            CDS       T00244                                 

Gene name
tuf
Definition
(GenBank) ELONGATION FACTOR TU
  KO
K02358  
elongation factor Tu
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Brite
Translation factors [BR:cgb03012]
 Eukaryotic Type
  Elongation factors
   cg0587 (tuf)
 Prokaryotic Type
   cg0587 (tuf)
Mitochondrial biogenesis [BR:cgb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    cg0587 (tuf)
Exosome [BR:cgb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   cg0587 (tuf)
  Exosomal proteins of breast cancer cells
   cg0587 (tuf)
  Exosomal proteins of colorectal cancer cells
   cg0587 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
526375..527565
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADTYPELNEAFAFDSIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVEDEEIIELVEMEVRELLAEQDYDEEAPIVHISALKAL
EGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGTLNV
NDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVIVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgacacttac
cctgagctcaacgaggctttcgccttcgactccatcgataaggctcctgaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagactgaaaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgattaccggcgctgctcag
atggacggcgcaatcctcgttgttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgaggatgaggaaatcatcgagctcgtcgagatggaagttcgtgaacttctt
gctgagcaggactacgacgaagaggctccaattgttcacatctccgctctgaaggctctt
gagggcgacgagaagtggggcaagcagatccttgagctcatgcaggcttgcgatgacaac
atccctgacccagttcgtgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggtaccctgaacgtg
aacgatgatgttgacatcatcggcatcaaggagaagtccacctccaccaccgttaccggt
atcgagatgttccgtaagcttcttgactccgctgaggctggcgacaactgtggtctgctt
ctccgtggtatcaagcgcgaagatgttgagcgtggccaggttatcgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggatgaaggtggc
cgccacaccccattcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttccagagggcaccgagatggtcatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgtttcgctatccgc
gaaggctcccgcaccgttggcgctggtcgtgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system