KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1787Help
Entry
cg1787            CDS       T00244                                 

Gene name
ppc
Definition
(GenBank) PHOSPHOENOLPYRUVATE CARBOXYLASE
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cg1787 (ppc)
  Energy metabolism
   00680 Methane metabolism
    cg1787 (ppc)
Enzymes [BR:cgb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     cg1787 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1678851..1681610)
Genome map
AA seq 919 aa AA seqDB search
MTDFLRDDIRFLGQILGEVIAEQEGQEVYELVEQARLTSFDIAKGNAEMDSLVQVFDGIT
PAKATPIARAFSHFALLANLAEDLYDEELREQALDAGDTPPDSTLDATWLKLNEGNVGAE
AVADVLRNAEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLDEI
EKNIRRRITILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRERFGE
GVPLKPVVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELSLSDR
MNKVTPQLLALADAGHNDVPSRVDEPYRRAVHGVRGRILATTAELIGEDAVEGVWFKVFT
PYASPEEFLNDALTIDHSLRESKDVLIADDRLSVLISAIESFGFNLYALDLRQNSESYED
VLTELFERAQVTANYRELSEAEKLEVLLKELRSPRPLIPHGSDEYSEVTDRELGIFRTAS
EAVKKFGPRMVPHCIISMASSVTDVLEPMVLLKEFGLIAANGDNPRGTVDVIPLFETIED
LQAGAGILDELWKIDLYRNYLLQRDNVQEVMLGYSDSNKDGGYFSANWALYDAELQLVEL
CRSAGVKLRLFHGRGGTVGRGGGPSYDAILAQPRGAVQGSVRITEQGEIISAKYGNPETA
RRNLEALVSATLEASLLDVSELTDHQRAYDIMSEISELSLKKYASLVHEDQGFIDYFTQS
TPLQEIGSLNIGSRPSSRKQTSSVEDLRAIPWVLSWSQSRVMLPGWFGVGTALEQWIGEG
EQATQRIAELQTLNESWPFFTSVLDNMAQVMSKAELRLAKLYADLIPDTEVAERVYSVIR
EEYFLTKKMFCVITGSDDLLDDNPLLARSVQRRYPYLLPLNVIQVEMMRRYRKGDQSEQV
SRNIQLTMNGLSTALRNSG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttttacgcgatgacatcaggttcctcggtcaaatcctcggtgaggtaatt
gcggaacaagaaggccaggaggtttatgaactggtcgaacaagcgcgcctgacttctttt
gatatcgccaagggcaacgccgaaatggatagcctggttcaggttttcgacggcattact
ccagccaaggcaacaccgattgctcgcgcattttcccacttcgctctgctggctaacctg
gcggaagacctctacgatgaagagcttcgtgaacaggctctcgatgcaggcgacacccct
ccggacagcactcttgatgccacctggctgaaactcaatgagggcaatgttggcgcagaa
gctgtggccgatgtgctgcgcaatgctgaggtggcgccggttctgactgcgcacccaact
gagactcgccgccgcactgtttttgatgcgcaaaagtggatcaccacccacatgcgtgaa
cgccacgctttgcagtctgcggagcctaccgctcgtacgcaaagcaagttggatgagatc
gagaagaacatccgccgtcgcatcaccattttgtggcagaccgcgttgattcgtgtggcc
cgcccacgtatcgaggacgagatcgaagtagggctgcgctactacaagctgagccttttg
gaagagattccacgtatcaaccgtgatgtggctgttgagcttcgtgagcgtttcggcgag
ggtgttcctttgaagcccgtggtcaagccaggttcctggattggtggagaccacgacggt
aacccttatgtcaccgcggaaacagttgagtattccactcaccgcgctgcggaaaccgtg
ctcaagtactatgcacgccagctgcattccctcgagcatgagctcagcctgtcggaccgc
atgaataaggtcaccccgcagctgcttgcgctggcagatgcagggcacaacgacgtgcca
agccgcgtggatgagccttatcgacgcgccgtccatggcgttcgcggacgtatcctcgcg
acgacggccgagctgatcggcgaggacgccgttgagggcgtgtggttcaaggtctttact
ccatacgcatctccggaagaattcttaaacgatgcgttgaccattgatcattctctgcgt
gaatccaaggacgttctcattgccgatgatcgtttgtctgtgctgatttctgccatcgag
agctttggattcaacctttacgcactggatctgcgccaaaactccgaaagctacgaggac
gtcctcaccgagcttttcgaacgcgcccaagtcaccgcaaactaccgcgagctgtctgaa
gcagagaagcttgaggtgctgctgaaggaactgcgcagccctcgtccgctgatcccgcac
ggttcagatgaatacagcgaggtcaccgaccgcgagctcggcatcttccgcaccgcgtcg
gaggctgttaagaaattcgggccacggatggtgcctcactgcatcatctccatggcatca
tcggtcaccgatgtgctcgagccgatggtgttgctcaaggaattcggactcatcgcagcc
aacggcgacaacccacgcggcaccgtcgatgtcatcccactgttcgaaaccatcgaagat
ctccaggccggcgccggaatcctcgacgaactgtggaaaattgatctctaccgcaactac
ctcctgcagcgcgacaacgtccaggaagtcatgctcggttactccgattccaacaaggat
ggcggatatttctccgcaaactgggcgctttacgacgcggaactgcagctcgtcgaacta
tgccgatcagccggggtcaagcttcgcctgttccacggccgtggtggcaccgtcggccgc
ggtggcggaccttcctacgacgcgattcttgcccagcccaggggggctgtccaaggttcc
gtgcgcatcaccgagcagggcgagatcatctccgctaagtacggcaaccccgaaaccgcg
cgccgaaacctcgaagccctggtctcagccacgcttgaggcatcgcttctcgacgtctcc
gaactcaccgatcaccaacgcgcgtacgacatcatgagtgagatctctgagctcagcttg
aagaagtacgcctccttggtgcacgaggatcaaggcttcatcgattacttcacccagtcc
acgccgctgcaggagattggatccctcaacatcggatccaggccttcctcacgcaagcag
acctcctcggtggaagatttgcgagccatcccatgggtgctcagctggtcacagtctcgt
gtcatgctgccaggctggtttggtgtcggaaccgcattagagcagtggattggcgaaggg
gagcaggccacccaacgcattgccgagctgcaaacactcaatgagtcctggccatttttc
acctcagtgttggataacatggctcaggtgatgtccaaggcagagctgcgtttggcaaag
ctctacgcagacctgatcccagatacggaagtagccgagcgagtctattccgtcatccgc
gaggagtacttcctgaccaagaagatgttctgcgtaatcaccggctctgatgatctgctt
gatgacaacccacttctcgcacgctctgtccagcgccgatacccctacctgcttccactc
aacgtgatccaggtagagatgatgcgacgctaccgaaaaggcgaccaaagcgagcaagtg
tcccgcaacattcagctgaccatgaacggtctttccactgcgctgcgcaactccggctag

DBGET integrated database retrieval system